BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fcaL-P03_F_N09
(510 letters)
Database: mosquito
2352 sequences; 563,979 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 23 6.0
AY578801-1|AAT07306.1| 506|Anopheles gambiae dSmad2 protein. 23 6.0
>AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein.
Length = 3398
Score = 23.0 bits (47), Expect = 6.0
Identities = 8/12 (66%), Positives = 10/12 (83%)
Frame = -1
Query: 216 STGATNGVNRPP 181
STG++N NRPP
Sbjct: 1627 STGSSNSCNRPP 1638
>AY578801-1|AAT07306.1| 506|Anopheles gambiae dSmad2 protein.
Length = 506
Score = 23.0 bits (47), Expect = 6.0
Identities = 16/64 (25%), Positives = 26/64 (40%)
Frame = +1
Query: 7 ADDSKTDSCVEESYSKLP*ST**LLYLRIARREQKLKEHGASSCISGKRGRRCCNIWHWG 186
A K S +EE L + + I+R + E+G + G CC +W W
Sbjct: 37 AKKMKKSSALEELERALTAQSSHTKCIPISRNASAIGENGVA-LKKGLPHVICCRLWRWP 95
Query: 187 SVDS 198
++S
Sbjct: 96 DLNS 99
Database: mosquito
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 563,979
Number of sequences in database: 2352
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 457,061
Number of Sequences: 2352
Number of extensions: 8902
Number of successful extensions: 12
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 12
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 12
length of database: 563,979
effective HSP length: 60
effective length of database: 422,859
effective search space used: 46091631
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -