Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P03_F_K04
         (464 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein.       24   2.3  
AB090812-1|BAC57899.1|  541|Anopheles gambiae gag-like protein p...    22   9.2  

>AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein.
          Length = 1009

 Score = 24.2 bits (50), Expect = 2.3
 Identities = 16/52 (30%), Positives = 23/52 (44%)
 Frame = +3

Query: 24  THYYSSHDAF*STMGKDDKEDTGFGFKDKAKAEDTLRLLEEHDLNYRRLTVR 179
           TH++ SH           + D  FG     K  D   LL +HDL+   +TV+
Sbjct: 419 THFWHSHTGM-------QRGDGAFGALIIRKDNDIQELLYDHDLSEHVITVQ 463


>AB090812-1|BAC57899.1|  541|Anopheles gambiae gag-like protein
           protein.
          Length = 541

 Score = 22.2 bits (45), Expect = 9.2
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = -3

Query: 282 PRASSRTPPWPL 247
           P ASSR PP PL
Sbjct: 173 PSASSRQPPTPL 184


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 201,777
Number of Sequences: 2352
Number of extensions: 2030
Number of successful extensions: 3
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 563,979
effective HSP length: 59
effective length of database: 425,211
effective search space used: 40395045
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)