BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fcaL-P03_F_D04
(696 letters)
Database: uniref50
1,657,284 sequences; 575,637,011 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
UniRef50_P34335 Cluster: Probable phosphorylase b kinase regulat... 33 8.8
>UniRef50_P34335 Cluster: Probable phosphorylase b kinase regulatory
subunit alpha; n=2; Caenorhabditis|Rep: Probable
phosphorylase b kinase regulatory subunit alpha -
Caenorhabditis elegans
Length = 1226
Score = 32.7 bits (71), Expect = 8.8
Identities = 19/68 (27%), Positives = 36/68 (52%), Gaps = 4/68 (5%)
Frame = -3
Query: 622 KKLYTKNVLTKQELAFQAPQAS----KILNKSNNRDTIM*DM*YTIIVYVTNMSRSEPKI 455
+K T + +K+E P+ + KI+N++ D + IIVY+ ++ R+EPK+
Sbjct: 872 QKQITVGIASKKEEVITCPKTNEELEKIMNRAYGDDANSFTLAQEIIVYLGSLVRTEPKL 931
Query: 454 FSRFWKSR 431
F ++ R
Sbjct: 932 FLEMFRLR 939
Database: uniref50
Posted date: Oct 5, 2007 11:19 AM
Number of letters in database: 575,637,011
Number of sequences in database: 1,657,284
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 636,446,095
Number of Sequences: 1657284
Number of extensions: 11541323
Number of successful extensions: 27927
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 26988
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 27920
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 54958682807
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -