Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P02_pT_O23
         (576 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF531707-1|ABP57431.1|  138|Apis mellifera structural cuticle pr...    63   2e-12
AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.             22   5.0  

>EF531707-1|ABP57431.1|  138|Apis mellifera structural cuticle
           protein protein.
          Length = 138

 Score = 63.3 bits (147), Expect = 2e-12
 Identities = 30/66 (45%), Positives = 39/66 (59%)
 Frame = -3

Query: 292 YNTGYETSNGIKAQETGQLKNIGTENEALEVRGEFAYIGPDGVTYAVTYVANEGGFQPSA 113
           Y   +ETSNGI  QE+GQ K +  E   +  +G  +Y  PDG   ++TYVA+E GFQ   
Sbjct: 42  YINNFETSNGISHQESGQPKQVDNETPVVS-QGSDSYTAPDGQQVSITYVADENGFQVQG 100

Query: 112 PHIPKA 95
            HIP A
Sbjct: 101 SHIPTA 106


>AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.
          Length = 1598

 Score = 21.8 bits (44), Expect = 5.0
 Identities = 6/9 (66%), Positives = 8/9 (88%)
 Frame = -2

Query: 575 RPVRKCYFC 549
           +P+ KCYFC
Sbjct: 422 KPLDKCYFC 430


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 127,044
Number of Sequences: 438
Number of extensions: 2643
Number of successful extensions: 14
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 13
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 13
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 16626408
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)