SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P02_pT_L03
         (381 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

01_01_0647 - 4909311-4909412,4909538-4909610,4909930-4910047,491...    32   0.13 

>01_01_0647 -
           4909311-4909412,4909538-4909610,4909930-4910047,
           4910133-4910229,4910350-4910445,4910536-4910631,
           4910725-4910871,4911877-4911987,4912582-4912620
          Length = 292

 Score = 32.3 bits (70), Expect = 0.13
 Identities = 20/69 (28%), Positives = 35/69 (50%), Gaps = 4/69 (5%)
 Frame = +3

Query: 132 RALFR*LFSNNHLYNSKCRSQIITLKLNYTIKLKWKS*W----RLIQYQSHILHSTNVQF 299
           + L R  F + +L   K  + I+ LK+ +  +LK         R ++ QSH+ H   ++ 
Sbjct: 33  KPLGRGKFGHVYLAREKRSNHIVALKVLFKSQLKQSQVEHQLRREVEIQSHLRHPNILRL 92

Query: 300 YMYLYDKTK 326
           Y Y YD+T+
Sbjct: 93  YGYFYDQTR 101


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 5,190,870
Number of Sequences: 37544
Number of extensions: 64751
Number of successful extensions: 144
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 143
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 144
length of database: 14,793,348
effective HSP length: 74
effective length of database: 12,015,092
effective search space used: 624784784
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -