SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P02_pT_I23
         (323 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY331183-1|AAP94623.1|  953|Apis mellifera NMDA-type glutamate r...    22   1.6  
AB231585-1|BAE17127.1|  898|Apis mellifera Mahya protein.              22   2.1  
DQ869051-1|ABJ09598.1|  581|Apis mellifera pyrokinin-like recept...    21   3.7  
AY569721-1|AAS86674.1|  400|Apis mellifera complementary sex det...    20   8.6  

>AY331183-1|AAP94623.1|  953|Apis mellifera NMDA-type glutamate
           receptor 1 protein.
          Length = 953

 Score = 22.2 bits (45), Expect = 1.6
 Identities = 10/21 (47%), Positives = 13/21 (61%)
 Frame = +1

Query: 250 TINQTSCISLCPDDVIGSYKI 312
           TIN T  ++L PD   G+Y I
Sbjct: 473 TINFTYSLALSPDGQFGNYII 493


>AB231585-1|BAE17127.1|  898|Apis mellifera Mahya protein.
          Length = 898

 Score = 21.8 bits (44), Expect = 2.1
 Identities = 7/13 (53%), Positives = 9/13 (69%)
 Frame = +2

Query: 209 FAYGYTSHNDHKN 247
           F YGY SH + +N
Sbjct: 662 FKYGYVSHANQRN 674


>DQ869051-1|ABJ09598.1|  581|Apis mellifera pyrokinin-like receptor
           2 protein.
          Length = 581

 Score = 21.0 bits (42), Expect = 3.7
 Identities = 11/32 (34%), Positives = 17/32 (53%)
 Frame = +1

Query: 22  IQITLQIVLCIIY*KKKNTKKLSIVKNNRNHL 117
           + +T+ IVL I+   K    ++     NRNHL
Sbjct: 232 LPMTIIIVLYILIAIKLRRSRMLTATVNRNHL 263


>AY569721-1|AAS86674.1|  400|Apis mellifera complementary sex
           determiner protein.
          Length = 400

 Score = 19.8 bits (39), Expect = 8.6
 Identities = 7/10 (70%), Positives = 7/10 (70%)
 Frame = +1

Query: 178 YKNNYYFINN 207
           Y NNYY  NN
Sbjct: 313 YSNNYYNNNN 322


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 89,543
Number of Sequences: 438
Number of extensions: 1626
Number of successful extensions: 4
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 146,343
effective HSP length: 50
effective length of database: 124,443
effective search space used:  7093251
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 39 (20.8 bits)

- SilkBase 1999-2023 -