BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_pT_E21 (810 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC417.07c |mto1|mbo1, mod20|MT organizer Mto1|Schizosaccharomy... 29 0.59 SPAC31A2.05c |mis4||cohesin loading factor Mis4|Schizosaccharomy... 28 1.8 SPBC106.09 |cut4|apc1|anaphase-promoting complex subunit Apc1|Sc... 27 2.4 SPAC4G8.03c |||RNA-binding protein|Schizosaccharomyces pombe|chr... 27 3.2 SPBC16H5.05c |cyp7|cwf27|cyclophilin family peptidyl-prolyl cis-... 25 9.6 >SPCC417.07c |mto1|mbo1, mod20|MT organizer Mto1|Schizosaccharomyces pombe|chr 3|||Manual Length = 1115 Score = 29.5 bits (63), Expect = 0.59 Identities = 15/52 (28%), Positives = 28/52 (53%) Frame = -2 Query: 677 KELASSACKSTDELLSQTKKSIDDITTSARRSMDDISSKAKSTLDDIEKLTK 522 K L + +S ++ LSQ K ++ +TTS D +S+ + D+++ L K Sbjct: 689 KLLLNEQIESLNDQLSQLKTEMESVTTSKESLADYLSNLKERHNDELDSLNK 740 >SPAC31A2.05c |mis4||cohesin loading factor Mis4|Schizosaccharomyces pombe|chr 1|||Manual Length = 1583 Score = 27.9 bits (59), Expect = 1.8 Identities = 14/28 (50%), Positives = 17/28 (60%) Frame = -2 Query: 635 LSQTKKSIDDITTSARRSMDDISSKAKS 552 L KKS DDITT +R M+D S +S Sbjct: 177 LCSPKKSKDDITTPKKRLMEDTYSPRES 204 >SPBC106.09 |cut4|apc1|anaphase-promoting complex subunit Apc1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1458 Score = 27.5 bits (58), Expect = 2.4 Identities = 13/46 (28%), Positives = 23/46 (50%) Frame = -2 Query: 758 LTNXISLNAGKGRQAIEWVIGKFDTEIKELASSACKSTDELLSQTK 621 L N + +++ + +WV K D E+KE+ + TD L T+ Sbjct: 641 LVNRLDVDSFLHPKTPKWVFNKQDQEVKEIKALTSTVTDSTLVDTQ 686 >SPAC4G8.03c |||RNA-binding protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 780 Score = 27.1 bits (57), Expect = 3.2 Identities = 12/41 (29%), Positives = 22/41 (53%) Frame = +1 Query: 547 SVLFALDEISSIDLLADVVMSSIDFFVCDNNSSVLLQAELA 669 +++ L I LL +++ S+ CDNN + +LQ +A Sbjct: 554 NIIDKLTSNEQISLLLKIIIPSLTTLACDNNGTHVLQKCIA 594 >SPBC16H5.05c |cyp7|cwf27|cyclophilin family peptidyl-prolyl cis-trans isomerase Cyp7|Schizosaccharomyces pombe|chr 2|||Manual Length = 463 Score = 25.4 bits (53), Expect = 9.6 Identities = 14/45 (31%), Positives = 24/45 (53%) Frame = -2 Query: 665 SSACKSTDELLSQTKKSIDDITTSARRSMDDISSKAKSTLDDIEK 531 +SA S+DE Q + +S++ + + S+ KS L D+EK Sbjct: 267 TSAKVSSDEYARQVDTLDTKLNSSSKSKVQEEISRLKSELRDLEK 311 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,177,058 Number of Sequences: 5004 Number of extensions: 62698 Number of successful extensions: 163 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 158 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 163 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 394431430 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -