BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_pT_E08 (399 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 23 1.3 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 22 3.0 DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex det... 21 3.9 AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. 21 6.9 DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated... 20 9.1 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 20 9.1 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 20 9.1 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 20 9.1 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 23.0 bits (47), Expect = 1.3 Identities = 11/31 (35%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = -2 Query: 161 CILRGPSPRPTLLQA-YPFXLVLAVGSKEYL 72 C+LR +P P +L+A + VL V ++ +L Sbjct: 1106 CVLRASTPAPVVLEAVHASRRVLIVLTRNFL 1136 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.8 bits (44), Expect = 3.0 Identities = 11/37 (29%), Positives = 15/37 (40%) Frame = -1 Query: 240 LTTARTSLILPKTTTLMETATNLSTTVHITWTVPKAD 130 +TT T+ TTT T N + T P+ D Sbjct: 658 ITTITTTTTTTTTTTTTTTTPNTTQNASATTPPPQVD 694 Score = 20.2 bits (40), Expect = 9.1 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = -3 Query: 214 PPKDYNPNGNGYEPIDNGAYYVDRPQGRP 128 PP+D+ P Y +D + D+P P Sbjct: 417 PPEDWKPLDKCYFCLDGKLPHDDQPPLSP 445 >DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex determiner protein. Length = 191 Score = 21.4 bits (43), Expect = 3.9 Identities = 14/54 (25%), Positives = 22/54 (40%) Frame = -3 Query: 271 LISNRNGYEPIDNRPYIVNPPKDYNPNGNGYEPIDNGAYYVDRPQGRPYFKPTP 110 +IS+ + +N Y N +YN N N Y Y ++ + P P P Sbjct: 81 IISSLSNKTIHNNNNYNNNNYNNYNYNNNNYNNYKKLYYNINYIEQIPVPVPVP 134 >AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. Length = 429 Score = 20.6 bits (41), Expect = 6.9 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = -3 Query: 199 NPNGNGYEPIDNGAYYVDRP 140 N GN + D+GA DRP Sbjct: 254 NAAGNNEDSSDSGAAASDRP 273 >DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 469 Score = 20.2 bits (40), Expect = 9.1 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +3 Query: 339 SRVITGENIKVVLI 380 S ITG N+K VL+ Sbjct: 109 SSAITGNNVKDVLV 122 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 20.2 bits (40), Expect = 9.1 Identities = 6/21 (28%), Positives = 12/21 (57%) Frame = -3 Query: 205 DYNPNGNGYEPIDNGAYYVDR 143 +YN N Y+P+ Y+++ Sbjct: 323 NYNNYNNNYKPLHYNINYIEQ 343 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 20.2 bits (40), Expect = 9.1 Identities = 8/29 (27%), Positives = 14/29 (48%) Frame = -1 Query: 210 PKTTTLMETATNLSTTVHITWTVPKADLT 124 P+ +ETA S ++++ W D T Sbjct: 908 PQPPNSLETAMVASRSINVKWQHKSQDTT 936 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 20.2 bits (40), Expect = 9.1 Identities = 8/29 (27%), Positives = 14/29 (48%) Frame = -1 Query: 210 PKTTTLMETATNLSTTVHITWTVPKADLT 124 P+ +ETA S ++++ W D T Sbjct: 904 PQPPNSLETAMVASRSINVKWQHKSQDTT 932 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 112,353 Number of Sequences: 438 Number of extensions: 2899 Number of successful extensions: 9 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 9885360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -