BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_pT_D06 (303 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ182015-1|ABA56307.1| 353|Anopheles gambiae G(alpha)q2 protein. 22 5.9 AY724805-1|AAW50314.1| 162|Anopheles gambiae G protein alpha su... 22 5.9 AY724804-1|AAW50313.1| 163|Anopheles gambiae G protein alpha su... 22 5.9 U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra... 21 7.8 AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 21 7.8 >DQ182015-1|ABA56307.1| 353|Anopheles gambiae G(alpha)q2 protein. Length = 353 Score = 21.8 bits (44), Expect = 5.9 Identities = 9/31 (29%), Positives = 17/31 (54%), Gaps = 2/31 (6%) Frame = +3 Query: 165 VIPMYTDISTKQRTHIYLHTTC--PYESVKF 251 ++ M+ D++ IY H TC E+++F Sbjct: 303 ILRMFVDLNPDSEKIIYSHFTCATDTENIRF 333 >AY724805-1|AAW50314.1| 162|Anopheles gambiae G protein alpha subunit AgGq3 protein. Length = 162 Score = 21.8 bits (44), Expect = 5.9 Identities = 9/31 (29%), Positives = 17/31 (54%), Gaps = 2/31 (6%) Frame = +3 Query: 165 VIPMYTDISTKQRTHIYLHTTC--PYESVKF 251 ++ M+ D++ IY H TC E+++F Sbjct: 116 ILRMFVDLNPDSEKIIYSHFTCATDTENIRF 146 >AY724804-1|AAW50313.1| 163|Anopheles gambiae G protein alpha subunit AgGq2 protein. Length = 163 Score = 21.8 bits (44), Expect = 5.9 Identities = 9/31 (29%), Positives = 17/31 (54%), Gaps = 2/31 (6%) Frame = +3 Query: 165 VIPMYTDISTKQRTHIYLHTTC--PYESVKF 251 ++ M+ D++ IY H TC E+++F Sbjct: 117 ILRMFVDLNPDSEKIIYSHFTCATDTENIRF 147 >U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse transcriptase protein. Length = 1049 Score = 21.4 bits (43), Expect = 7.8 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -1 Query: 180 CTWGLRSELMYVII*CYC 127 C+W R+ L I CYC Sbjct: 800 CSWCKRNGLTICIEKCYC 817 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 21.4 bits (43), Expect = 7.8 Identities = 7/18 (38%), Positives = 10/18 (55%) Frame = -2 Query: 287 VICF*HCACVWLEFYRFV 234 + C C VWL+F +V Sbjct: 784 IFCVWDCCWVWLKFQEWV 801 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 329,084 Number of Sequences: 2352 Number of extensions: 5733 Number of successful extensions: 11 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 563,979 effective HSP length: 55 effective length of database: 434,619 effective search space used: 19557855 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -