BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_pT_D06 (303 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AK129846-1|BAC85241.1| 236|Homo sapiens protein ( Homo sapiens ... 30 1.5 AK128083-1|BAC87264.1| 225|Homo sapiens protein ( Homo sapiens ... 28 4.7 >AK129846-1|BAC85241.1| 236|Homo sapiens protein ( Homo sapiens cDNA FLJ26336 fis, clone HRT02842. ). Length = 236 Score = 29.9 bits (64), Expect = 1.5 Identities = 21/71 (29%), Positives = 35/71 (49%) Frame = -3 Query: 280 VFSTVRVFGSNFTDS*GHVVCK*ICVRCFVLISVYMGITLRIDVCNYLMLLLSVWHRVLG 101 VF+ V+ S FT + HV ICV ++ I VY+ I + I +C Y + + + Sbjct: 156 VFTCTHVYISVFTCT--HVY---ICVFIYICIHVYIHIYICIHICVYSYIHMYTYIHTYT 210 Query: 100 RECTALLYNNI 68 T L +N++ Sbjct: 211 YTYTQLFFNHL 221 >AK128083-1|BAC87264.1| 225|Homo sapiens protein ( Homo sapiens cDNA FLJ46204 fis, clone TESTI4009501. ). Length = 225 Score = 28.3 bits (60), Expect = 4.7 Identities = 17/56 (30%), Positives = 29/56 (51%), Gaps = 4/56 (7%) Frame = +3 Query: 144 LHTSILSVIPMYTDISTKQRTHIYLHT----TCPYESVKFEPNTRTVLKTNDNSNS 299 +HT IL++ M+T T TH + HT T + +TRT+ T+ +++S Sbjct: 105 MHTRILTLSHMHTHAHTHAHTHGHTHTRAHSTHAHTHAHSHYHTRTLTLTHSHAHS 160 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 41,982,369 Number of Sequences: 237096 Number of extensions: 748153 Number of successful extensions: 1264 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1209 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1263 length of database: 76,859,062 effective HSP length: 77 effective length of database: 58,602,670 effective search space used: 1347861410 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -