BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_pT_D04 (766 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. 26 1.5 AJ438610-6|CAD27478.1| 226|Anopheles gambiae hypothetical prote... 25 1.9 AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubu... 25 2.6 AJ000675-1|CAA04232.1| 600|Anopheles gambiae infection responsi... 24 4.5 AF004915-1|AAB94671.1| 688|Anopheles gambiae pro-phenol oxidase... 24 5.9 >DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. Length = 847 Score = 25.8 bits (54), Expect = 1.5 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -3 Query: 755 PAVPSVTPAPPQQFVTVVPAQQMGPEPT 672 P + S+ P P VT++ QQ+ +PT Sbjct: 749 PVMESIPPPPKPPTVTMMDMQQLDTQPT 776 >AJ438610-6|CAD27478.1| 226|Anopheles gambiae hypothetical protein protein. Length = 226 Score = 25.4 bits (53), Expect = 1.9 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = -3 Query: 581 CLIGCCPCACIPYC 540 CL C P C+P+C Sbjct: 150 CLSKCSPTKCVPFC 163 >AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubule binding protein protein. Length = 838 Score = 25.0 bits (52), Expect = 2.6 Identities = 13/36 (36%), Positives = 16/36 (44%) Frame = -3 Query: 746 PSVTPAPPQQFVTVVPAQQMGPEPTNTSCPSCSAAI 639 PS+ P P VT PA+ P PT P A + Sbjct: 88 PSLAPVVPSSVVTAPPARPSQP-PTTRFAPEPRAEV 122 Score = 24.2 bits (50), Expect = 4.5 Identities = 11/33 (33%), Positives = 15/33 (45%) Frame = -3 Query: 755 PAVPSVTPAPPQQFVTVVPAQQMGPEPTNTSCP 657 P V + +PAP VVP+ + P S P Sbjct: 77 PTVLAASPAPQPSLAPVVPSSVVTAPPARPSQP 109 >AJ000675-1|CAA04232.1| 600|Anopheles gambiae infection responsive serine proteaselike protein protein. Length = 600 Score = 24.2 bits (50), Expect = 4.5 Identities = 10/22 (45%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = -3 Query: 533 SCKDANHY-CPNCNAYIGSYNR 471 +C DA HY CP+ + + S NR Sbjct: 58 TCSDATHYCCPDRSEQLPSRNR 79 >AF004915-1|AAB94671.1| 688|Anopheles gambiae pro-phenol oxidase subunit 1 protein. Length = 688 Score = 23.8 bits (49), Expect = 5.9 Identities = 6/9 (66%), Positives = 8/9 (88%) Frame = +3 Query: 612 HWHVIYSGD 638 HWH++Y GD Sbjct: 210 HWHLVYPGD 218 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 785,552 Number of Sequences: 2352 Number of extensions: 16283 Number of successful extensions: 43 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 41 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 43 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 79418373 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -