BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_pT_D04 (766 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g14920.1 68418.m01750 gibberellin-regulated family protein si... 29 3.4 At1g66610.1 68414.m07569 seven in absentia (SINA) protein, putat... 28 5.9 At3g58560.1 68416.m06527 endonuclease/exonuclease/phosphatase fa... 28 7.8 At1g66630.1 68414.m07571 seven in absentia (SINA) family protein... 28 7.8 >At5g14920.1 68418.m01750 gibberellin-regulated family protein similar to SP|P46689 Gibberellin-regulated protein 1 precursor {Arabidopsis thaliana}; contains Pfam profile PF02704: Gibberellin regulated protein Length = 275 Score = 29.1 bits (62), Expect = 3.4 Identities = 27/96 (28%), Positives = 35/96 (36%), Gaps = 8/96 (8%) Frame = -3 Query: 755 PAVPSVTPAPPQQFVTVVPAQQMGPEPTNTSC-PSCSAAIVTRVDHVPVTKTHL------ 597 P V T PP Q T P PT P + TR+D VP+ T Sbjct: 171 PPVKPPTTTPPVQPPTYNPPTTPVKPPTAPPVKPPTPPPVRTRIDCVPLCGTRCGQHSRK 230 Query: 596 -FALLLCLIGCCPCACIPYCTDSCKDANHYCPNCNA 492 + C+ C C C+P T K+ C +C A Sbjct: 231 NVCMRACVTCCYRCKCVPPGTYGNKEK---CGSCYA 263 >At1g66610.1 68414.m07569 seven in absentia (SINA) protein, putative similar to SIAH1 protein [Brassica napus var. napus] GI:7657876; contains Pfam profile PF03145: Seven in absentia protein family Length = 366 Score = 28.3 bits (60), Expect = 5.9 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = -3 Query: 542 CTDSCKDANHYCPNCNAYIGSYNR*IFQLV 453 C+ C + ++ CP C+ IG+Y I + V Sbjct: 77 CSSCCTNVSNKCPYCSLAIGNYRSRIMERV 106 >At3g58560.1 68416.m06527 endonuclease/exonuclease/phosphatase family protein similar to SP|P31384 Glucose-repressible alcohol dehydrogenase transcriptional effector (Carbon catabolite repressor protein 4) {Saccharomyces cerevisiae}; contains Pfam profile PF03372: Endonuclease/Exonuclease/phosphatase family Length = 602 Score = 27.9 bits (59), Expect = 7.8 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = +2 Query: 326 HI*TYLFFKVKSDIYLVLCSVHSSK 400 H Y +F+V+SD + +CSVH S+ Sbjct: 47 HFLKYRWFRVQSDKKVAICSVHPSE 71 >At1g66630.1 68414.m07571 seven in absentia (SINA) family protein similar to SIAH1 protein [Brassica napus var. napus] GI:7657876; contains Pfam profile PF03145: Seven in absentia protein family Length = 303 Score = 27.9 bits (59), Expect = 7.8 Identities = 11/40 (27%), Positives = 20/40 (50%), Gaps = 2/40 (5%) Frame = -3 Query: 542 CTDSCKDANHYCPNCNAYIGSYNR*IFQLV--Q*IINCKN 429 C+ CK + CP C+ IG + I + + +++C N Sbjct: 70 CSSCCKKVKYKCPYCSLRIGFFRSRILEKIVEAVVVSCPN 109 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,606,327 Number of Sequences: 28952 Number of extensions: 324168 Number of successful extensions: 867 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 806 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 865 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1712086600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -