BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_pT_D01 (720 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g43600.1 68415.m05419 glycoside hydrolase family 19 protein s... 30 1.8 At3g01270.1 68416.m00033 pectate lyase family protein similar to... 27 9.5 >At2g43600.1 68415.m05419 glycoside hydrolase family 19 protein similar to basic endochitinase CHB4 precursor SP:Q06209 from [Brassica napus] Length = 273 Score = 29.9 bits (64), Expect = 1.8 Identities = 13/29 (44%), Positives = 18/29 (62%), Gaps = 2/29 (6%) Frame = +1 Query: 364 NVIFDIYLLILQLGVYF--NCLQFSCPGL 444 NVIF +++L + F NC+ SCPGL Sbjct: 5 NVIFSLFILAILAETVFSQNCMDTSCPGL 33 >At3g01270.1 68416.m00033 pectate lyase family protein similar to pectate lyase P59 SP:P15722 from [Lycopersicon esculentum] Length = 475 Score = 27.5 bits (58), Expect = 9.5 Identities = 9/32 (28%), Positives = 20/32 (62%) Frame = +3 Query: 54 LEFLHTYLTHGIHISRIR*LSFQVLKDSTGYF 149 ++++H + HG+H+ I S +++DS +F Sbjct: 233 MQYVHNIIIHGLHVHHIVKSSGGLIRDSINHF 264 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,355,562 Number of Sequences: 28952 Number of extensions: 242299 Number of successful extensions: 403 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 400 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 403 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1565336320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -