BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_pT_C22 (720 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g19230.2 68417.m02837 cytochrome P450 family protein cytochro... 31 0.58 At5g17930.1 68418.m02102 MA3 domain-containing protein low simil... 31 1.0 At5g17240.1 68418.m02020 SET domain-containing protein contains ... 29 3.1 At4g08310.1 68417.m01372 expressed protein glutamic acid-rich pr... 29 4.1 At4g02710.1 68417.m00366 kinase interacting family protein simil... 29 4.1 At1g80410.1 68414.m09413 acetyltransferase-related low similarit... 29 4.1 At5g31412.1 68418.m03722 hypothetical protein contains Pfam doma... 28 5.4 At1g66130.1 68414.m07505 oxidoreductase N-terminal domain-contai... 28 5.4 At2g26780.1 68415.m03212 expressed protein contains Pfam profile... 27 9.5 At2g04230.1 68415.m00410 F-box family protein contains F-box dom... 27 9.5 >At4g19230.2 68417.m02837 cytochrome P450 family protein cytochrome P450, Arabidopsis thaliana; supported by cDNA: gi_15293092_gb_AY050980.1_ Length = 484 Score = 31.5 bits (68), Expect = 0.58 Identities = 16/32 (50%), Positives = 19/32 (59%) Frame = +1 Query: 400 ERASGLSRGSISHNSRLFGEGCCLCWPGKRQS 495 ERA+G S G +SR C LCWPG R+S Sbjct: 439 ERATGFSMG----HSRFPKTDCPLCWPGSRRS 466 >At5g17930.1 68418.m02102 MA3 domain-containing protein low similarity to SP|Q9P6R9 Cell cycle control protein cwf22 {Schizosaccharomyces pombe}; contains Pfam profile PF02847: MA3 domain Length = 707 Score = 30.7 bits (66), Expect = 1.0 Identities = 25/104 (24%), Positives = 47/104 (45%), Gaps = 2/104 (1%) Frame = -3 Query: 703 ADCLSETKADE--QLVNKLKTGDFKTENEPLKKYALCMLIKSQLMTKDGKFKKDVALAKV 530 A+ ++ET E + LK + + N +K C+++ S+ F+K + L + Sbjct: 479 AEDIAETMDAEVVEAQKMLKLAEAQRMNTDSRKAIFCVIMSSEDYID--AFEKLLRL-DL 535 Query: 529 PNAEDKLKVEKLIDACLANKGNSPHQTAWNYVKCYHEKDPKHAL 398 P +D+ + L++ CL K + T C H+K+ K L Sbjct: 536 PGKQDREIMRVLVECCLQEKAFNKFYTVLASKLCEHDKNHKFTL 579 >At5g17240.1 68418.m02020 SET domain-containing protein contains Pfam profile PF00856: SET domain Length = 491 Score = 29.1 bits (62), Expect = 3.1 Identities = 17/67 (25%), Positives = 32/67 (47%), Gaps = 1/67 (1%) Frame = -3 Query: 619 LKKYALCMLI-KSQLMTKDGKFKKDVALAKVPNAEDKLKVEKLIDACLANKGNSPHQTAW 443 LKK L + + + LMT + KD+ L+ N + L +++ CL + + ++ W Sbjct: 57 LKKGELVLKVPRKALMTTESIIAKDLKLSDAVNLHNSLSSTQILSVCLLYEMSKEKKSFW 116 Query: 442 NYVKCYH 422 Y +H Sbjct: 117 -YPYLFH 122 >At4g08310.1 68417.m01372 expressed protein glutamic acid-rich protein precursor - Plasmodium falciparum, PIR2:A54514 Length = 504 Score = 28.7 bits (61), Expect = 4.1 Identities = 19/53 (35%), Positives = 27/53 (50%) Frame = -3 Query: 718 LKXHRADCLSETKADEQLVNKLKTGDFKTENEPLKKYALCMLIKSQLMTKDGK 560 +K H CL+ + DE N L+T + K + P+K+ A L K KDGK Sbjct: 83 VKQHLVQCLAGAENDETSENSLET-EKKDDVTPVKEAA--ELSKEHTTKKDGK 132 >At4g02710.1 68417.m00366 kinase interacting family protein similar to kinase interacting protein 1 (GI:13936326) [Petunia integrifolia] Length = 1111 Score = 28.7 bits (61), Expect = 4.1 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = +1 Query: 379 DYVFTRKERASGLSRGSISHNSRLFGEGCCL 471 DYVFT +E A +S+G+ + L EG CL Sbjct: 781 DYVFTHRESAGEVSKGADLMDEFLKLEGMCL 811 >At1g80410.1 68414.m09413 acetyltransferase-related low similarity to acetyltransferase Tubedown-1 [Mus musculus] GI:8497318, N-TERMINAL ACETYLTRANSFERASE GB:P12945 from (Saccharomyces cerevisiae); contains Pfam profile PF00515 TPR Domain Length = 897 Score = 28.7 bits (61), Expect = 4.1 Identities = 14/38 (36%), Positives = 26/38 (68%) Frame = +3 Query: 135 KKSPRSIKRDKQSYDEHKRKLNFISRLNMLKQQNKIYR 248 KK P+ + DK SY E ++++ +S++ L++ NK+YR Sbjct: 214 KKEPKIV--DKLSYKE--QEVSLLSKVGRLEEANKLYR 247 >At5g31412.1 68418.m03722 hypothetical protein contains Pfam domain, PF04937: Protein of unknown function (DUF 659) Length = 433 Score = 28.3 bits (60), Expect = 5.4 Identities = 20/64 (31%), Positives = 31/64 (48%), Gaps = 2/64 (3%) Frame = -3 Query: 709 HRADCLSETKADEQLVNKLKT-GDFKTENEPLKKYALCMLIKSQLMTKD-GKFKKDVALA 536 H D + E + + K++T GD+K EN L +Y C+L + +D G K + LA Sbjct: 227 HTVDLMLEAISKLPKMGKMQTFGDYKGENLFLNRYESCVLEWCDVCVEDFGPLMKLLRLA 286 Query: 535 KVPN 524 N Sbjct: 287 DGEN 290 >At1g66130.1 68414.m07505 oxidoreductase N-terminal domain-containing protein similar to AX110P [Daucus carota] GI:285739; contains Pfam profile PF01408: Oxidoreductase family NAD-binding Rossmann fold Length = 364 Score = 28.3 bits (60), Expect = 5.4 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = -3 Query: 556 KKDVALAKVPNAEDKLKVEKLIDACLANKGNSPHQTAW 443 KK L + P A+D ++EK+++AC N T W Sbjct: 95 KKKHVLVEKPPAQDATELEKIVEACEYNGVQFMDGTIW 132 >At2g26780.1 68415.m03212 expressed protein contains Pfam profile TBP (TATA-binding protein) -interacting protein 120 (TIP120); contains TIGRFAM profile TIGR01612: reticulocyte binding protein Length = 1866 Score = 27.5 bits (58), Expect = 9.5 Identities = 10/27 (37%), Positives = 18/27 (66%) Frame = -2 Query: 488 RLPGQQRQQPSPNSLELCEMLPRERPE 408 R P ++R++ +PN+LE LP++ E Sbjct: 114 RAPAKEREEIAPNTLENVSKLPKQHQE 140 >At2g04230.1 68415.m00410 F-box family protein contains F-box domain Pfam:PF00646 Length = 448 Score = 27.5 bits (58), Expect = 9.5 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = -3 Query: 526 NAEDKLKVEKLIDACLANKGNSPHQTAWNYVKCYHE 419 ++ KL++ KL D L + +P + WN KC E Sbjct: 333 DSSPKLQILKLTDVYLHDNKTNPDERKWNPPKCAPE 368 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,993,648 Number of Sequences: 28952 Number of extensions: 276867 Number of successful extensions: 669 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 659 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 669 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1565336320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -