BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_pT_C19 (612 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q17EN3 Cluster: Leucine-rich transmembrane protein; n=1... 41 0.027 UniRef50_UPI0000DB74EA Cluster: PREDICTED: similar to Gp150 CG58... 38 0.25 UniRef50_UPI00015B561B Cluster: PREDICTED: similar to leucine-ri... 37 0.33 UniRef50_Q6C2H0 Cluster: Similarity; n=1; Yarrowia lipolytica|Re... 35 1.8 UniRef50_UPI0000D57381 Cluster: PREDICTED: similar to CG5820-PD,... 34 2.3 UniRef50_Q4UG65 Cluster: Putative uncharacterized protein; n=1; ... 33 5.3 UniRef50_Q4CME0 Cluster: Putative uncharacterized protein; n=1; ... 33 7.1 UniRef50_Q23R94 Cluster: Putative uncharacterized protein; n=1; ... 33 7.1 UniRef50_Q6D9Q6 Cluster: Putative membrane protein; n=1; Pectoba... 32 9.3 >UniRef50_Q17EN3 Cluster: Leucine-rich transmembrane protein; n=1; Aedes aegypti|Rep: Leucine-rich transmembrane protein - Aedes aegypti (Yellowfever mosquito) Length = 945 Score = 40.7 bits (91), Expect = 0.027 Identities = 21/53 (39%), Positives = 31/53 (58%) Frame = -1 Query: 525 RTRQLRYNSAIIAAMSQPGRTKKDCGLVYQQLSEDLTGPATPKLSRYAPLHSV 367 R R RY A++A+ + +VYQ+L+ED+ P TPK+ RYAP+ V Sbjct: 902 RKRGERYRQALLASKNS---------IVYQKLTEDIVAPKTPKVHRYAPIQQV 945 >UniRef50_UPI0000DB74EA Cluster: PREDICTED: similar to Gp150 CG5820-PD, isoform D; n=1; Apis mellifera|Rep: PREDICTED: similar to Gp150 CG5820-PD, isoform D - Apis mellifera Length = 886 Score = 37.5 bits (83), Expect = 0.25 Identities = 21/55 (38%), Positives = 29/55 (52%) Frame = -1 Query: 459 KDCGLVYQQLSEDLTGPATPKLSRYAPLHSVTVNASNMSYESSPFHHNNIVPEAV 295 K+CGLVY+ L E++ P PK + Y SS FH++ IVPE+V Sbjct: 846 KNCGLVYKPLQEEIATPHVPKRGSF--------------YSSSTFHYDKIVPESV 886 >UniRef50_UPI00015B561B Cluster: PREDICTED: similar to leucine-rich transmembrane protein; n=1; Nasonia vitripennis|Rep: PREDICTED: similar to leucine-rich transmembrane protein - Nasonia vitripennis Length = 887 Score = 37.1 bits (82), Expect = 0.33 Identities = 21/55 (38%), Positives = 29/55 (52%) Frame = -1 Query: 459 KDCGLVYQQLSEDLTGPATPKLSRYAPLHSVTVNASNMSYESSPFHHNNIVPEAV 295 K+CGLVY+ L E++ P PK + Y SS FH++ IVPE+V Sbjct: 847 KNCGLVYKPLQEEIATPHMPKRGSF--------------YSSSTFHYDKIVPESV 887 >UniRef50_Q6C2H0 Cluster: Similarity; n=1; Yarrowia lipolytica|Rep: Similarity - Yarrowia lipolytica (Candida lipolytica) Length = 145 Score = 34.7 bits (76), Expect = 1.8 Identities = 18/43 (41%), Positives = 25/43 (58%) Frame = -1 Query: 438 QQLSEDLTGPATPKLSRYAPLHSVTVNASNMSYESSPFHHNNI 310 Q+ + D TG +TPKLS Y PL V +SY+S+ H +I Sbjct: 47 QEPNHDTTGSSTPKLSIYDPLIKDEVIQKLLSYQSTKTHLKHI 89 >UniRef50_UPI0000D57381 Cluster: PREDICTED: similar to CG5820-PD, isoform D; n=1; Tribolium castaneum|Rep: PREDICTED: similar to CG5820-PD, isoform D - Tribolium castaneum Length = 680 Score = 34.3 bits (75), Expect = 2.3 Identities = 17/30 (56%), Positives = 21/30 (70%) Frame = -1 Query: 474 PGRTKKDCGLVYQQLSEDLTGPATPKLSRY 385 PG+ KK G VY+ LSEDL G TP ++RY Sbjct: 639 PGQ-KKHSGSVYRPLSEDLYGSRTPIINRY 667 >UniRef50_Q4UG65 Cluster: Putative uncharacterized protein; n=1; Theileria annulata|Rep: Putative uncharacterized protein - Theileria annulata Length = 104 Score = 33.1 bits (72), Expect = 5.3 Identities = 20/56 (35%), Positives = 31/56 (55%), Gaps = 3/56 (5%) Frame = +3 Query: 60 NSFVICLRFVXCSFKKKALAHL-VELLLECTH--KGTNMKCVKYLLCD*RVYSITC 218 N+F+I LR V +FK+K +L V +LLE GT + C ++ C+ + I C Sbjct: 36 NTFIIVLRLVKQNFKEKLRDYLDVIVLLEVLFFWDGTKLSCTLHVNCETSLVRIAC 91 >UniRef50_Q4CME0 Cluster: Putative uncharacterized protein; n=1; Trypanosoma cruzi|Rep: Putative uncharacterized protein - Trypanosoma cruzi Length = 232 Score = 32.7 bits (71), Expect = 7.1 Identities = 21/57 (36%), Positives = 28/57 (49%), Gaps = 1/57 (1%) Frame = -3 Query: 475 TRPHQKGLRLGIPAVVRRPHRSGHSKTKPICSTSQRHCQC-IQHVL*EQSLPPQQHR 308 +R HQ G+ G PA RR +R GH P+C Q C + +L L P+Q R Sbjct: 96 SRGHQ-GVSHGPPAA-RRSYRGGHDCVPPVCGELQLRASCLLVRLLARCMLAPKQTR 150 >UniRef50_Q23R94 Cluster: Putative uncharacterized protein; n=1; Tetrahymena thermophila SB210|Rep: Putative uncharacterized protein - Tetrahymena thermophila SB210 Length = 1170 Score = 32.7 bits (71), Expect = 7.1 Identities = 21/80 (26%), Positives = 40/80 (50%), Gaps = 6/80 (7%) Frame = -1 Query: 528 SRTRQLRYNSAIIAAMSQPGRTKKDCGLVYQQLSE--DLTGPATPKLSRYAPLH----SV 367 S+T ++ S + ++Q R L YQ + + D+ P LS +A LH ++ Sbjct: 798 SKTEDVKTISQLQEELTQANRKINQFELEYQNMKKTYDVFKPQPQPLSSHAALHQIINNI 857 Query: 366 TVNASNMSYESSPFHHNNIV 307 +NAS++ ++ F HN ++ Sbjct: 858 QLNASSIVIPNNNFSHNQVI 877 >UniRef50_Q6D9Q6 Cluster: Putative membrane protein; n=1; Pectobacterium atrosepticum|Rep: Putative membrane protein - Erwinia carotovora subsp. atroseptica (Pectobacterium atrosepticum) Length = 160 Score = 32.3 bits (70), Expect = 9.3 Identities = 18/60 (30%), Positives = 29/60 (48%) Frame = +1 Query: 187 CVTSAYILSLVA*KRVSSVVSFMI*LLKIKFCTCGSHCFWHDVVVVEGTALIGHVGCIDS 366 CV + LS +A + + +V SF L+ I C G + FW + +G GH G + + Sbjct: 95 CVNKSVALSEIAHRDLKNVNSFYCFLVLISMCIEGVYRFWLSHKMSKGVYGYGHGGAVSA 154 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 537,856,301 Number of Sequences: 1657284 Number of extensions: 10141139 Number of successful extensions: 25826 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 25012 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25809 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 43977329078 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -