BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_pT_C19 (612 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglu... 25 0.50 EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 prot... 25 0.66 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 23 2.0 AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory recept... 23 2.7 DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. 21 8.2 AM292357-1|CAL23169.2| 355|Tribolium castaneum gustatory recept... 21 8.2 >EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglucosaminidase NAG3 protein. Length = 582 Score = 25.0 bits (52), Expect = 0.50 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +3 Query: 147 THKGTNMKCVKYLLCD*RVYSITC 218 T K N KCVKYL+ D TC Sbjct: 45 TWKCENQKCVKYLVEDEETSLATC 68 >EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 protein. Length = 475 Score = 24.6 bits (51), Expect = 0.66 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = -1 Query: 402 PKLSRYAPLHSVTVNASNMSYESSPFHHNNIVPEAV*AT 286 P LS+Y + +V S++ HH+ + P AV T Sbjct: 193 PALSKYLDIINVMAYDLRGSWDGVTGHHSGLYPSAVDTT 231 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 23.0 bits (47), Expect = 2.0 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -2 Query: 353 PTCPMRAVPSTTTTSCQKQCEPH 285 P P A+ STTT S + +PH Sbjct: 1397 PHAPQIALTSTTTNSLTFKLKPH 1419 >AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory receptor candidate 51 protein. Length = 771 Score = 22.6 bits (46), Expect = 2.7 Identities = 15/56 (26%), Positives = 26/56 (46%) Frame = -1 Query: 435 QLSEDLTGPATPKLSRYAPLHSVTVNASNMSYESSPFHHNNIVPEAV*ATRTKFNF 268 Q+ E +T SRYA L+ + + +ES ++H I+ E V + F + Sbjct: 319 QIIELMTSVVKSLESRYADLNENFLQCQDEKFESFVYYH-RILGETVDLFNSLFGY 373 >DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. Length = 414 Score = 21.0 bits (42), Expect = 8.2 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -1 Query: 435 QLSEDLTGPATPKLSRYAP 379 +L + +T ATP + YAP Sbjct: 274 RLRKQITSAATPLVRSYAP 292 >AM292357-1|CAL23169.2| 355|Tribolium castaneum gustatory receptor candidate 36 protein. Length = 355 Score = 21.0 bits (42), Expect = 8.2 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = +3 Query: 24 SFVSSLIICLIFNSFVICLRFVXCS 98 +F S I+ +FN+F L + CS Sbjct: 255 NFTISYILFALFNTFGTILLIMTCS 279 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 131,405 Number of Sequences: 336 Number of extensions: 2738 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15561709 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -