BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_pT_C19 (612 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC3G9.12 |peg1|cls1|CLASP family microtubule-associated protei... 29 0.70 SPAC30C2.07 |||sequence orphan|Schizosaccharomyces pombe|chr 1||... 27 1.6 SPAC16E8.04c |||chorismate mutase |Schizosaccharomyces pombe|chr... 27 2.8 SPAP7G5.02c |gua2||GMP synthase [glutamine-hydrolyzing] |Schizos... 27 2.8 >SPAC3G9.12 |peg1|cls1|CLASP family microtubule-associated protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 1462 Score = 28.7 bits (61), Expect = 0.70 Identities = 14/39 (35%), Positives = 23/39 (58%) Frame = -2 Query: 512 SDTTVPLLQR*VNPAAPKRTAAWYTSSCPKTSQVRPLQN 396 ++T P + + ++ A P R AA + S PK + +RPL N Sbjct: 487 TNTLEPSVLKQLHLANPNRQAASFNFSGPKRAPIRPLSN 525 >SPAC30C2.07 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 842 Score = 27.5 bits (58), Expect = 1.6 Identities = 16/56 (28%), Positives = 28/56 (50%), Gaps = 4/56 (7%) Frame = -2 Query: 359 MHPTCPMRAVPSTTTTSCQKQCEPHVQNLIFKSYIM----KLTTELTLFQATSDRI 204 +HP + S T S QK+ + ++NL+F S K T + L Q++S ++ Sbjct: 345 VHPVSTYYTMLSNFTLSLQKEIDERIRNLLFVSLSSGGDNKNDTGIPLIQSSSSKV 400 >SPAC16E8.04c |||chorismate mutase |Schizosaccharomyces pombe|chr 1|||Manual Length = 251 Score = 26.6 bits (56), Expect = 2.8 Identities = 15/43 (34%), Positives = 23/43 (53%) Frame = -1 Query: 429 SEDLTGPATPKLSRYAPLHSVTVNASNMSYESSPFHHNNIVPE 301 +++L P PK S PLH VN ++ E ++ N IVP+ Sbjct: 85 TDNLPEPILPKFSGKFPLHPNNVNVNS---EILEYYINEIVPK 124 >SPAP7G5.02c |gua2||GMP synthase [glutamine-hydrolyzing] |Schizosaccharomyces pombe|chr 1|||Manual Length = 539 Score = 26.6 bits (56), Expect = 2.8 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = -2 Query: 293 EPHVQNLIFKSYIMKLTTELTLFQATSDRIYAL 195 EP ++ +FKS+ + E ++ + DR+ AL Sbjct: 126 EPEIKTEVFKSFFNSMPKEFEVWMSHGDRLSAL 158 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,223,829 Number of Sequences: 5004 Number of extensions: 42893 Number of successful extensions: 126 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 124 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 126 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 267622334 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -