BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_pT_C19 (612 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_21607| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_54032| Best HMM Match : Peptidase_A17 (HMM E-Value=5.20022e-42) 28 6.9 SB_12261| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_8902| Best HMM Match : DUF1070 (HMM E-Value=0.76) 28 6.9 SB_4714| Best HMM Match : Cuticle_2 (HMM E-Value=5.9) 28 6.9 SB_30442| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 >SB_21607| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 259 Score = 29.1 bits (62), Expect = 3.0 Identities = 14/58 (24%), Positives = 28/58 (48%) Frame = -1 Query: 504 NSAIIAAMSQPGRTKKDCGLVYQQLSEDLTGPATPKLSRYAPLHSVTVNASNMSYESS 331 N+ I+ R K+CG+V++ +S D TG + ++ T+ S +++S Sbjct: 92 NTNILQTQDTQAREHKNCGMVHRGMSTD-TGQQPQGSQNLSRMNHATIEGSPQGFQNS 148 >SB_54032| Best HMM Match : Peptidase_A17 (HMM E-Value=5.20022e-42) Length = 832 Score = 27.9 bits (59), Expect = 6.9 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -3 Query: 502 QCHYCSDESTRPHQKGLRLGIP 437 QC + +D S+ PH KGL+L P Sbjct: 271 QCKHHTDVSSMPHLKGLKLAHP 292 >SB_12261| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 430 Score = 27.9 bits (59), Expect = 6.9 Identities = 13/34 (38%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = +1 Query: 271 IKFCT-CGSHCFWHDVVVVEGTALIGHVGCIDSD 369 IK CT CG+H WH ++ +G H C D Sbjct: 226 IKKCTACGTHGLWHSQLLFQGYTK-SHPQCFSMD 258 >SB_8902| Best HMM Match : DUF1070 (HMM E-Value=0.76) Length = 544 Score = 27.9 bits (59), Expect = 6.9 Identities = 13/34 (38%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = +1 Query: 271 IKFCT-CGSHCFWHDVVVVEGTALIGHVGCIDSD 369 IK CT CG+H WH ++ +G H C D Sbjct: 72 IKKCTACGTHGLWHSQLLFQGYTK-SHPQCFSMD 104 >SB_4714| Best HMM Match : Cuticle_2 (HMM E-Value=5.9) Length = 165 Score = 27.9 bits (59), Expect = 6.9 Identities = 13/34 (38%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = +1 Query: 271 IKFCT-CGSHCFWHDVVVVEGTALIGHVGCIDSD 369 IK CT CG+H WH ++ +G H C D Sbjct: 70 IKKCTACGTHGLWHSQLLFQGYTK-SHPQCFSMD 102 >SB_30442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 218 Score = 27.5 bits (58), Expect = 9.1 Identities = 17/40 (42%), Positives = 20/40 (50%) Frame = -3 Query: 415 RSGHSKTKPICSTSQRHCQCIQHVL*EQSLPPQQHRARSS 296 RSG KT + STS + E+SLPP R RSS Sbjct: 11 RSGKGKTALLSSTSGKAAASTLKPHYEKSLPPPNIRPRSS 50 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,312,681 Number of Sequences: 59808 Number of extensions: 347063 Number of successful extensions: 1248 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 833 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1241 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1499981500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -