BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_pT_C18 (728 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC049170-1|AAH49170.1| 388|Homo sapiens angiopoietin-like 5 pro... 30 9.8 AY358827-1|AAQ89186.1| 388|Homo sapiens ANGPTL5 protein. 30 9.8 AY169281-1|AAO38749.1| 388|Homo sapiens putative fibrinogen-lik... 30 9.8 >BC049170-1|AAH49170.1| 388|Homo sapiens angiopoietin-like 5 protein. Length = 388 Score = 29.9 bits (64), Expect = 9.8 Identities = 17/44 (38%), Positives = 24/44 (54%) Frame = -3 Query: 540 DFMKKWPDYLSD*INRKDEFKIGSMKG*VNYIVNPSYSSIMLHL 409 DF + W DYL + EF +G K + YIVN +S ML++ Sbjct: 204 DFQRLWCDYLDGFGDLLGEFWLGLKK--IFYIVNQKNTSFMLYV 245 >AY358827-1|AAQ89186.1| 388|Homo sapiens ANGPTL5 protein. Length = 388 Score = 29.9 bits (64), Expect = 9.8 Identities = 17/44 (38%), Positives = 24/44 (54%) Frame = -3 Query: 540 DFMKKWPDYLSD*INRKDEFKIGSMKG*VNYIVNPSYSSIMLHL 409 DF + W DYL + EF +G K + YIVN +S ML++ Sbjct: 204 DFQRLWCDYLDGFGDLLGEFWLGLKK--IFYIVNQKNTSFMLYV 245 >AY169281-1|AAO38749.1| 388|Homo sapiens putative fibrinogen-like protein protein. Length = 388 Score = 29.9 bits (64), Expect = 9.8 Identities = 17/44 (38%), Positives = 24/44 (54%) Frame = -3 Query: 540 DFMKKWPDYLSD*INRKDEFKIGSMKG*VNYIVNPSYSSIMLHL 409 DF + W DYL + EF +G K + YIVN +S ML++ Sbjct: 204 DFQRLWCDYLDGFGDLLGEFWLGLKK--IFYIVNQKNTSFMLYV 245 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 78,115,187 Number of Sequences: 237096 Number of extensions: 1322222 Number of successful extensions: 6181 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6143 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6181 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8623170556 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -