BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_pT_C18 (728 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL023847-4|CAA19550.1| 349|Caenorhabditis elegans Hypothetical ... 30 1.9 AC006661-10|AAF39887.1| 843|Caenorhabditis elegans Hypothetical... 29 2.6 >AL023847-4|CAA19550.1| 349|Caenorhabditis elegans Hypothetical protein Y57A10C.8 protein. Length = 349 Score = 29.9 bits (64), Expect = 1.9 Identities = 13/45 (28%), Positives = 27/45 (60%), Gaps = 1/45 (2%) Frame = -3 Query: 411 LLAY-DVLISFYHKMSFVFFLS*FCCNMFSL*SYDVNVIVVNCFV 280 LL Y D+L + M+ V+ ++ CC + ++ S+ +N ++ CF+ Sbjct: 15 LLQYSDILHLLFVCMAMVYLVTDVCCLVAAVLSFCINFFIITCFL 59 >AC006661-10|AAF39887.1| 843|Caenorhabditis elegans Hypothetical protein H20J04.1 protein. Length = 843 Score = 29.5 bits (63), Expect = 2.6 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -3 Query: 717 IYKEGDLVAVKKTQFGTGMKLKPKF 643 +YK+ DL V TQ GTG+ + P F Sbjct: 250 VYKKVDLTRVSATQVGTGVAISPFF 274 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,932,978 Number of Sequences: 27780 Number of extensions: 228706 Number of successful extensions: 516 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 503 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 516 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1718929214 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -