BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_pT_C13 (444 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578801-1|AAT07306.1| 506|Anopheles gambiae dSmad2 protein. 23 4.9 AY578805-1|AAT07310.1| 753|Anopheles gambiae medea protein. 23 6.4 >AY578801-1|AAT07306.1| 506|Anopheles gambiae dSmad2 protein. Length = 506 Score = 23.0 bits (47), Expect = 4.9 Identities = 16/64 (25%), Positives = 26/64 (40%) Frame = -2 Query: 428 ADDSKTDSCVEESYSKLP*ST**LLYLRIARREQKLKEHGASSCISGKRGRRCCNIWHWG 249 A K S +EE L + + I+R + E+G + G CC +W W Sbjct: 37 AKKMKKSSALEELERALTAQSSHTKCIPISRNASAIGENGVA-LKKGLPHVICCRLWRWP 95 Query: 248 SVDS 237 ++S Sbjct: 96 DLNS 99 >AY578805-1|AAT07310.1| 753|Anopheles gambiae medea protein. Length = 753 Score = 22.6 bits (46), Expect = 6.4 Identities = 14/37 (37%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = -3 Query: 145 AGSIVSQLTAAA-MVAPTP*GDAKHHPFSTSLPGSDL 38 AGS+ +AAA M++ + G +H S+SLP S + Sbjct: 229 AGSVGGPSSAAAAMLSASSGGQQQHARLSSSLPLSSV 265 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 437,952 Number of Sequences: 2352 Number of extensions: 8161 Number of successful extensions: 12 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 37418568 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -