BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_pT_C11 (756 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_16632| Best HMM Match : HSP20 (HMM E-Value=1e-12) 33 0.19 SB_29958| Best HMM Match : Pkinase (HMM E-Value=2.6e-08) 30 1.8 SB_12805| Best HMM Match : LicD (HMM E-Value=9.7e-06) 30 2.3 SB_51159| Best HMM Match : DUF1140 (HMM E-Value=2.3) 29 3.1 SB_44720| Best HMM Match : Helicase_C (HMM E-Value=0.59) 29 3.1 SB_40833| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_34759| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_23757| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.4 SB_23414| Best HMM Match : Tetraspannin (HMM E-Value=3.8e-08) 29 5.4 SB_1181| Best HMM Match : DUF1604 (HMM E-Value=0) 28 7.1 SB_22969| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.4 SB_28816| Best HMM Match : PAS (HMM E-Value=0.0047) 28 9.4 SB_18879| Best HMM Match : Pkinase_Tyr (HMM E-Value=7e-36) 28 9.4 SB_867| Best HMM Match : Leo1 (HMM E-Value=0) 28 9.4 >SB_16632| Best HMM Match : HSP20 (HMM E-Value=1e-12) Length = 210 Score = 33.5 bits (73), Expect = 0.19 Identities = 26/93 (27%), Positives = 45/93 (48%) Frame = -1 Query: 474 IFVQGSQEAKEDDHDVFASQFFHTYSLPVNSSAADVTAELTSDGYLVVTAPISENVDKTK 295 I + G ++ E +H S+F +Y+LP + V++ +T DG L + A +E + Sbjct: 64 IKIDGKHKS-EGEHGYETSEFHRSYNLPDGVDVSTVSSRITGDGLLHIEALKAE----PQ 118 Query: 294 NTERVVPIVETGAPYKKDEPVEKTTVETLDVST 196 TE + TG+ + +K TLDVS+ Sbjct: 119 ETEVSLVGASTGSAGDIAKIDDKRFTVTLDVSS 151 >SB_29958| Best HMM Match : Pkinase (HMM E-Value=2.6e-08) Length = 857 Score = 30.3 bits (65), Expect = 1.8 Identities = 19/62 (30%), Positives = 30/62 (48%) Frame = -3 Query: 229 KDDSRNLGRFYDSGAEDISSSGSDCSTGTRGEERTDHALRTR*SDRKRQRDPTRKRSFCL 50 KD+ RNLG+ D E+ S G++ G + E T + + Q P ++SF L Sbjct: 303 KDEDRNLGKNKDERHEEY-SKGNENMDGIKPFELTPEIEAIQSTTTDEQNKPNTEQSFLL 361 Query: 49 SD 44 S+ Sbjct: 362 SE 363 >SB_12805| Best HMM Match : LicD (HMM E-Value=9.7e-06) Length = 371 Score = 29.9 bits (64), Expect = 2.3 Identities = 21/62 (33%), Positives = 27/62 (43%) Frame = +2 Query: 563 ILGPMSTKVGISFHRGAKRLNGERFSHGNVNWSSVMVTGCAITSLSRAGKAVTVVKPAKA 742 I+GP+ K G F R G F NW V+ T T +S A + VV+PA Sbjct: 217 IMGPLWFKHGDIFPVARLRFEGFMFDVPR-NWKQVLRTLYGRTGISAAVPTLMVVEPAPT 275 Query: 743 MK 748 K Sbjct: 276 QK 277 >SB_51159| Best HMM Match : DUF1140 (HMM E-Value=2.3) Length = 444 Score = 29.5 bits (63), Expect = 3.1 Identities = 17/39 (43%), Positives = 21/39 (53%) Frame = -1 Query: 684 AQPVTITDDQFTFPWLNLSPFSLFAPLWKLIPTFVDIGP 568 + P T T DQ + + + SPFS APL P FVD P Sbjct: 219 SSPETFTSDQLSPTYSSPSPFSSKAPL----PVFVDFTP 253 >SB_44720| Best HMM Match : Helicase_C (HMM E-Value=0.59) Length = 625 Score = 29.5 bits (63), Expect = 3.1 Identities = 18/51 (35%), Positives = 25/51 (49%) Frame = -1 Query: 402 YSLPVNSSAADVTAELTSDGYLVVTAPISENVDKTKNTERVVPIVETGAPY 250 YS+ S + SD YL+ TA +SE +D + R V I TG P+ Sbjct: 171 YSITRGHSVMSEHLNIISDRYLLFTAQVSEGLDFSDINGRAVVI--TGLPF 219 >SB_40833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1300 Score = 29.5 bits (63), Expect = 3.1 Identities = 16/47 (34%), Positives = 22/47 (46%) Frame = -3 Query: 268 RDWRSVQEGRACRKDDSRNLGRFYDSGAEDISSSGSDCSTGTRGEER 128 R WR+V R C + S + D GA + + + C TGT E R Sbjct: 343 RVWRTVPPQRVCLEVPSEKARKIPDDGALTVRTEATGC-TGTANEIR 388 >SB_34759| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 633 Score = 29.1 bits (62), Expect = 4.1 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = -3 Query: 145 TRGEERTDHALRTR*SDRKRQRDPTRKRSF 56 TRG ER++HA + RK +++ T+ SF Sbjct: 240 TRGHERSEHAEKAAELKRKEKKEATKHNSF 269 >SB_23757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2834 Score = 28.7 bits (61), Expect = 5.4 Identities = 17/59 (28%), Positives = 26/59 (44%) Frame = -1 Query: 399 SLPVNSSAADVTAELTSDGYLVVTAPISENVDKTKNTERVVPIVETGAPYKKDEPVEKT 223 ++PVN+ A G +VT ++ V + T V P+V A K EP +T Sbjct: 1250 TMPVNTQAVVANMVTQPHGTTIVTPAVANMVTQPHGTTIVTPVVTQSAVATK-EPARRT 1307 >SB_23414| Best HMM Match : Tetraspannin (HMM E-Value=3.8e-08) Length = 357 Score = 28.7 bits (61), Expect = 5.4 Identities = 16/46 (34%), Positives = 26/46 (56%) Frame = +3 Query: 12 ILISLNANTKLSLKQKLRFRVGSRCLFLSLHRVRRAWSVLSSPRVP 149 IL +L + K S+KQ LRF S +F++ + + ++ S RVP Sbjct: 112 ILCTLGCSRKPSIKQ-LRFYRSSFVIFITFEIIVMVFGIIQSSRVP 156 >SB_1181| Best HMM Match : DUF1604 (HMM E-Value=0) Length = 1035 Score = 28.3 bits (60), Expect = 7.1 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = -1 Query: 462 GSQEAKEDDHDVFASQFFHTYSLPVNSSAA 373 G+ +E+D DV+A Y +P N SAA Sbjct: 245 GTGVFEEEDDDVYAQDIMSNYDIPKNISAA 274 >SB_22969| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 817 Score = 27.9 bits (59), Expect = 9.4 Identities = 19/63 (30%), Positives = 28/63 (44%) Frame = -1 Query: 438 DHDVFASQFFHTYSLPVNSSAADVTAELTSDGYLVVTAPISENVDKTKNTERVVPIVETG 259 D DV+A Q YS PV + + + G L T + +KT+N + I+E Sbjct: 61 DFDVYAHQSETEYSGPVPDPNSRPSGTYSKIGTLNATKLWTSFGNKTQNVQTFSLILENS 120 Query: 258 APY 250 PY Sbjct: 121 KPY 123 >SB_28816| Best HMM Match : PAS (HMM E-Value=0.0047) Length = 405 Score = 27.9 bits (59), Expect = 9.4 Identities = 15/46 (32%), Positives = 26/46 (56%), Gaps = 2/46 (4%) Frame = +1 Query: 556 SVDSWPDVHKSGDQFPQRSKKTEWRKVQPWEREL--VICNGDGLRD 687 +V S+ + KSG P R++ T +R PW +E+ ++C D L + Sbjct: 135 AVSSYRFLCKSGHYIPLRTRSTLFR--NPWTKEIEFLVCTNDVLTE 178 >SB_18879| Best HMM Match : Pkinase_Tyr (HMM E-Value=7e-36) Length = 617 Score = 27.9 bits (59), Expect = 9.4 Identities = 19/63 (30%), Positives = 27/63 (42%) Frame = -1 Query: 438 DHDVFASQFFHTYSLPVNSSAADVTAELTSDGYLVVTAPISENVDKTKNTERVVPIVETG 259 D DV+A Q YS PV + + G L T +KT+N + + I+E Sbjct: 137 DFDVYAHQSETQYSGPVPDPNNSPSGTCSKIGTLNATELSPSLGNKTQNVQTLSLILENS 196 Query: 258 APY 250 PY Sbjct: 197 KPY 199 >SB_867| Best HMM Match : Leo1 (HMM E-Value=0) Length = 591 Score = 27.9 bits (59), Expect = 9.4 Identities = 16/49 (32%), Positives = 24/49 (48%), Gaps = 1/49 (2%) Frame = -3 Query: 205 RFYDSGAEDISSSG-SDCSTGTRGEERTDHALRTR*SDRKRQRDPTRKR 62 R Y S +D G D + GEER +A + S+ + +P+RKR Sbjct: 517 RAYSSEEDDGEEEGLGDLESDNEGEERLMNAKEGKDSEEESIEEPSRKR 565 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,256,599 Number of Sequences: 59808 Number of extensions: 346866 Number of successful extensions: 1370 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 1276 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1367 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2058295707 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -