BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_pT_C11 (756 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF283275-1|AAG15376.1| 133|Anopheles gambiae small heat shock p... 66 1e-12 AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 pro... 27 0.83 AY214334-1|AAP69612.1| 519|Anopheles gambiae nicotinate phospho... 24 4.4 AF281078-2|AAF82132.1| 755|Anopheles gambiae vitellogenin 2 pro... 24 4.4 Y17717-1|CAA76832.1| 101|Anopheles gambiae cE5 protein protein. 23 7.7 AY263176-1|AAP78791.1| 705|Anopheles gambiae TmcB-like protein ... 23 7.7 >AF283275-1|AAG15376.1| 133|Anopheles gambiae small heat shock protein protein. Length = 133 Score = 66.1 bits (154), Expect = 1e-12 Identities = 31/77 (40%), Positives = 43/77 (55%) Frame = -1 Query: 474 IFVQGSQEAKEDDHDVFASQFFHTYSLPVNSSAADVTAELTSDGYLVVTAPISENVDKTK 295 + V+G E K+DDH + F Y LP + AD+ + L+SDG L +T P E + K Sbjct: 38 VLVEGKHEEKQDDHGYVSRHFVRRYMLPKGHNEADIVSSLSSDGILTITCPRKE--IEQK 95 Query: 294 NTERVVPIVETGAPYKK 244 N ER +PI TG P K+ Sbjct: 96 NEERSIPITHTGQPMKQ 112 >AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 protein. Length = 2051 Score = 26.6 bits (56), Expect = 0.83 Identities = 15/54 (27%), Positives = 27/54 (50%) Frame = -3 Query: 226 DDSRNLGRFYDSGAEDISSSGSDCSTGTRGEERTDHALRTR*SDRKRQRDPTRK 65 DDS + S ++ SSS SD S+ + EE + + T +K+ ++ R+ Sbjct: 363 DDSSSSSSSSSSDSDSDSSSSSDSSSSSSEEEAENFKISTAEQYKKQAKEVERR 416 >AY214334-1|AAP69612.1| 519|Anopheles gambiae nicotinate phosphoribosyltransferase-like protein protein. Length = 519 Score = 24.2 bits (50), Expect = 4.4 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = -3 Query: 133 ERTDHALRTR*SDRKRQRDPTRKRSFCLSDNL 38 ER +LRT D KR +PT + +SDNL Sbjct: 471 ERVQASLRTLRQDHKRTLNPTPYK-VAVSDNL 501 >AF281078-2|AAF82132.1| 755|Anopheles gambiae vitellogenin 2 protein. Length = 755 Score = 24.2 bits (50), Expect = 4.4 Identities = 14/54 (25%), Positives = 26/54 (48%) Frame = -3 Query: 226 DDSRNLGRFYDSGAEDISSSGSDCSTGTRGEERTDHALRTR*SDRKRQRDPTRK 65 DDS + S ++ SSS SD S+ + EE + + +K+ ++ R+ Sbjct: 363 DDSSSSSSSSSSDSDSDSSSSSDSSSSSSEEEAENFKISPAEQYKKQAKEVERR 416 >Y17717-1|CAA76832.1| 101|Anopheles gambiae cE5 protein protein. Length = 101 Score = 23.4 bits (48), Expect = 7.7 Identities = 12/33 (36%), Positives = 15/33 (45%) Frame = -3 Query: 139 GEERTDHALRTR*SDRKRQRDPTRKRSFCLSDN 41 GEE D +L +D RDP R F + N Sbjct: 54 GEEEFDPSLLEEHADAPTARDPGRNPEFLRNSN 86 >AY263176-1|AAP78791.1| 705|Anopheles gambiae TmcB-like protein protein. Length = 705 Score = 23.4 bits (48), Expect = 7.7 Identities = 10/40 (25%), Positives = 20/40 (50%) Frame = -1 Query: 357 LTSDGYLVVTAPISENVDKTKNTERVVPIVETGAPYKKDE 238 L + GYL++ P+SE + T+ + + G ++E Sbjct: 533 LLTHGYLIMQVPVSEGCGPFRGTQYMYQLFMQGILKLREE 572 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 632,767 Number of Sequences: 2352 Number of extensions: 10647 Number of successful extensions: 22 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 78170964 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -