BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_pT_C09 (777 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. 27 0.65 U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra... 24 4.6 >AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. Length = 1009 Score = 27.1 bits (57), Expect = 0.65 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +1 Query: 490 LPHIITCFVSQGTTMRYAIDA 552 +PH+ C +S GTT RY A Sbjct: 394 VPHVSQCPISPGTTFRYTFRA 414 >U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse transcriptase protein. Length = 1049 Score = 24.2 bits (50), Expect = 4.6 Identities = 12/38 (31%), Positives = 17/38 (44%) Frame = -1 Query: 195 YLQDRLGLKKMDKAGKLIFLSTPGDHLRFTEEWMIKNI 82 Y Q+ GL+ K L D + TE W++ NI Sbjct: 83 YYQNVRGLRTKTKEFHLAVSEADFDLIALTETWLVDNI 120 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 784,325 Number of Sequences: 2352 Number of extensions: 15375 Number of successful extensions: 20 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 81081585 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -