BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_pT_C08 (710 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81070-9|CAB03002.1| 132|Caenorhabditis elegans Hypothetical pr... 100 9e-22 U88181-2|AAB42303.1| 491|Caenorhabditis elegans Dnaj domain (pr... 31 0.61 AF106575-1|AAC78174.2| 537|Caenorhabditis elegans Aldehyde dehy... 29 4.3 >Z81070-9|CAB03002.1| 132|Caenorhabditis elegans Hypothetical protein F26E4.9 protein. Length = 132 Score = 100 bits (240), Expect = 9e-22 Identities = 44/88 (50%), Positives = 63/88 (71%), Gaps = 1/88 (1%) Frame = -3 Query: 486 PDPLEHATGLERKELLALQAGNDDPFNMKVVKKS-AGTRENPTLVPSCFDARIVGCICEE 310 PDPLEHATG E+K LLA AG DD + KV ++ A T++ P LVPS +D RI+GC+CE+ Sbjct: 40 PDPLEHATGREKKMLLARLAG-DDRYEPKVYYRAEASTKQKPNLVPSHYDFRIIGCMCEQ 98 Query: 309 HATAITWLWLHKDQPRRCECGHWYKLIE 226 + + ++ + K P+RCECGHW+K ++ Sbjct: 99 DSGHVNFMTIRKGDPKRCECGHWFKGVD 126 >U88181-2|AAB42303.1| 491|Caenorhabditis elegans Dnaj domain (prokaryotic heat shockprotein) protein 7 protein. Length = 491 Score = 31.5 bits (68), Expect = 0.61 Identities = 17/44 (38%), Positives = 24/44 (54%) Frame = -3 Query: 501 ADKMMPDPLEHATGLERKELLALQAGNDDPFNMKVVKKSAGTRE 370 A ++ PD E GLE + L QAG D + + VK++A RE Sbjct: 351 ATEVNPDHREAKEGLEHAKRLKTQAGKRDYYKILGVKRNASKRE 394 >AF106575-1|AAC78174.2| 537|Caenorhabditis elegans Aldehyde dehydrogenase protein 2 protein. Length = 537 Score = 28.7 bits (61), Expect = 4.3 Identities = 24/78 (30%), Positives = 34/78 (43%) Frame = -1 Query: 485 LIPWNMPLAWKGRNSWPFRPAMMTPST*R**RSQQEPVKTQLWYLPALMLVLLDAFVKNT 306 +IPWN PL + +W PA+ +T + VKT L L L+ F + Sbjct: 202 IIPWNFPLLMQ---AWKLAPALAMGNT----VVMKVAVKTPLSALHVASLIKEAQFPEGV 254 Query: 305 LQPSPGFGYTRTNRAVAS 252 + PG G T A+AS Sbjct: 255 VNIIPGRG-TDAGEAIAS 271 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,400,692 Number of Sequences: 27780 Number of extensions: 397542 Number of successful extensions: 964 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 905 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 964 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1655655746 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -