BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_pT_C06 (746 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_0233 + 23801944-23802598,23802914-23803047,23803548-238037... 47 1e-05 03_02_0427 + 8367633-8368205,8369318-8369809,8370602-8370817,837... 29 3.9 11_04_0145 + 14082864-14082946,14083060-14083267,14083383-140835... 29 5.2 >04_04_0233 + 23801944-23802598,23802914-23803047,23803548-23803730, 23804145-23804318 Length = 381 Score = 47.2 bits (107), Expect = 1e-05 Identities = 44/164 (26%), Positives = 69/164 (42%), Gaps = 14/164 (8%) Frame = -3 Query: 561 GRGREKGDPAEALIYFEKGCELNDPGACLHAGMLLTATGPGVNIQRDVPKGYNCLKKSCD 382 G K + AL F++ L A + AG++ G +RD G C +K+ + Sbjct: 150 GAEGRKAERQRALGLFQRAARLGSAAAMVDAGLMCWEEG-----RRDEAVG--CYQKAAE 202 Query: 381 QNDDMACHYLSGMYLTGVPXNVQD----FNPHNPXKNKNIDYL----------IKPDKXE 244 + L YL P ++ F P N Y IK ++ E Sbjct: 203 LGHPVGMCNLGVSYLEADPPKAEEAVRWFYPAAAAGNARAQYNLGLCLQNGKGIKRNQRE 262 Query: 243 AFRFAKRACELGNMFACANVSLMYKXGDGVEKNQDESKRFFEIA 112 A ++ RA E GN+ A N+SL Y G+G ++Q SKR+ ++A Sbjct: 263 AAKWYLRAAEGGNVRAMYNISLCYNYGEGFSQDQVRSKRWLQLA 306 >03_02_0427 + 8367633-8368205,8369318-8369809,8370602-8370817, 8371914-8372237,8372991-8373233,8374056-8374250 Length = 680 Score = 29.1 bits (62), Expect = 3.9 Identities = 27/108 (25%), Positives = 45/108 (41%), Gaps = 1/108 (0%) Frame = -3 Query: 432 IQRDVPKGYNCLKKSCDQNDDMACHYLSGMYLTGVPXNVQDFNPHNPXKNKNIDYLIKPD 253 ++RD K Y+ K+ ++ D A L +Y G ++ + Sbjct: 276 VRRDYGKAYHWFSKAVEKGDTRAMELLGEIYARGAG--------------------VERN 315 Query: 252 KXEAFRFAKRACELGNMFACANVSLMYKXGDGVE-KNQDESKRFFEIA 112 EA+++ A + A + +Y G GVE KN ++K FFEIA Sbjct: 316 YTEAYKWLTLAAKQQQYSAYNGLGYLYVKGYGVEKKNLTKAKEFFEIA 363 >11_04_0145 + 14082864-14082946,14083060-14083267,14083383-14083599, 14084170-14084276,14085521-14085674,14086848-14087029 Length = 316 Score = 28.7 bits (61), Expect = 5.2 Identities = 16/39 (41%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = -3 Query: 492 DPGACLHAGMLLTATGPGVN-IQRDVPKGYNCLKKSCDQ 379 D G C + M + N IQRD KGY C K DQ Sbjct: 254 DGGHCKNENMFYSRVDVHANLIQRDFMKGYTCWVKHGDQ 292 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,184,292 Number of Sequences: 37544 Number of extensions: 351839 Number of successful extensions: 695 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 682 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 695 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1980691104 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -