BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_pT_C02 (707 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_08_0791 - 20590744-20591211,20591379-20591439,20591525-205915... 27 2.5 >10_08_0791 - 20590744-20591211,20591379-20591439,20591525-20591592, 20592015-20592188,20592291-20592331,20592571-20592620, 20593083-20593171,20593250-20593324,20593631-20593719, 20593895-20593955,20594111-20594227,20594465-20594667, 20594785-20594842,20594951-20595103 Length = 568 Score = 26.6 bits (56), Expect(2) = 2.5 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = -1 Query: 236 FYLNVMFYMSNVLIFKKMCVTVVQTIECTFILFKIYHLV 120 F L F+ + LI ++C+ VV C++I +Y LV Sbjct: 373 FGLRSCFHDNFELIIARVCLGVVVQFMCSYITLPLYALV 411 Score = 21.4 bits (43), Expect(2) = 2.5 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -1 Query: 392 HFYFGPIEIKFHLNNFIS 339 HF+FG + HL +F S Sbjct: 351 HFWFGKPRLVLHLIHFAS 368 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,751,710 Number of Sequences: 37544 Number of extensions: 204426 Number of successful extensions: 287 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 283 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 287 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1827423340 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -