BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_pT_C02 (707 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_40248| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_52197| Best HMM Match : TPR_2 (HMM E-Value=6.6e-10) 28 8.5 >SB_40248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 32.7 bits (71), Expect = 0.30 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +1 Query: 94 LNYIYLTNITRWYILNNINVHSMVCTTVTHIFLKINTLD 210 + Y +LT I R Y++NN+ + C TV H+ TLD Sbjct: 54 IRYTFLTQIPRTYLVNNMKIFVARC-TVKHVAKPCETLD 91 >SB_52197| Best HMM Match : TPR_2 (HMM E-Value=6.6e-10) Length = 536 Score = 27.9 bits (59), Expect = 8.5 Identities = 12/44 (27%), Positives = 23/44 (52%) Frame = +1 Query: 76 KSQKYLLNYIYLTNITRWYILNNINVHSMVCTTVTHIFLKINTL 207 K+ +Y ++ LT W + + N+HSM C + ++ I+ L Sbjct: 207 KAAEYFESFYNLTKGRIWQMDSGENLHSMSCENLRRVYTAISDL 250 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,334,610 Number of Sequences: 59808 Number of extensions: 283928 Number of successful extensions: 449 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 414 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 446 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1865706635 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -