BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_pT_B24 (807 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q2F5N9 Cluster: Nucleoplasmin isoform 2; n=7; Endoptery... 36 0.91 UniRef50_Q2J304 Cluster: Glycoside hydrolase, family 4 precursor... 34 4.8 >UniRef50_Q2F5N9 Cluster: Nucleoplasmin isoform 2; n=7; Endopterygota|Rep: Nucleoplasmin isoform 2 - Bombyx mori (Silk moth) Length = 187 Score = 36.3 bits (80), Expect = 0.91 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = -3 Query: 712 SQFKDDENKRKGAGKR 665 SQFK+DENKRKGAGKR Sbjct: 135 SQFKEDENKRKGAGKR 150 >UniRef50_Q2J304 Cluster: Glycoside hydrolase, family 4 precursor; n=6; Alphaproteobacteria|Rep: Glycoside hydrolase, family 4 precursor - Rhodopseudomonas palustris (strain HaA2) Length = 426 Score = 33.9 bits (74), Expect = 4.8 Identities = 21/65 (32%), Positives = 30/65 (46%), Gaps = 2/65 (3%) Frame = +1 Query: 472 RLHNLDIIIPKMATVR--LAQNGSPGGLFISWHSSWAMQLCLWHYSTFSLFCPWVHLLHY 645 RL +D +PK +R L +NG PGGLF + + + L CP L+Y Sbjct: 92 RLWKMDFEVPKKHGIRHPLGENGGPGGLFFTLRT---LPLVFDFIRDIEELCPEALFLNY 148 Query: 646 LHPHS 660 +P S Sbjct: 149 SNPES 153 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 623,843,069 Number of Sequences: 1657284 Number of extensions: 10904185 Number of successful extensions: 21561 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 20812 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21440 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 69554636255 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -