BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_pT_B24 (807 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g14000.2 68416.m01768 expressed protein 28 8.4 At3g14000.1 68416.m01767 expressed protein 28 8.4 >At3g14000.2 68416.m01768 expressed protein Length = 374 Score = 27.9 bits (59), Expect = 8.4 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = +3 Query: 462 VAPSPAQFRYNYT*NGDGTTSPKWVSRRFVHFLAFFLGDAALP 590 VA + +FRY Y G G+++PK + + L FL P Sbjct: 81 VASNSGRFRYAYKRAGSGSSTPKILGKEMESRLKGFLSGEGTP 123 >At3g14000.1 68416.m01767 expressed protein Length = 374 Score = 27.9 bits (59), Expect = 8.4 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = +3 Query: 462 VAPSPAQFRYNYT*NGDGTTSPKWVSRRFVHFLAFFLGDAALP 590 VA + +FRY Y G G+++PK + + L FL P Sbjct: 81 VASNSGRFRYAYKRAGSGSSTPKILGKEMESRLKGFLSGEGTP 123 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,587,289 Number of Sequences: 28952 Number of extensions: 239364 Number of successful extensions: 534 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 483 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 534 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1833827200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -