BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_pT_B22 (452 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 24 0.67 L10710-1|AAA27730.1| 382|Apis mellifera hyaluronidase protein. 21 4.7 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 21 8.3 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 21 8.3 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 21 8.3 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 24.2 bits (50), Expect = 0.67 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +1 Query: 19 KKKKNFTMQVQDFNAPGRKIKSVANH 96 KK N++MQV F + G +KS H Sbjct: 1147 KKYTNYSMQVLAFTSGGDGVKSAPIH 1172 >L10710-1|AAA27730.1| 382|Apis mellifera hyaluronidase protein. Length = 382 Score = 21.4 bits (43), Expect = 4.7 Identities = 10/43 (23%), Positives = 19/43 (44%) Frame = +1 Query: 1 YXFYIRKKKKNFTMQVQDFNAPGRKIKSVANHTFLYWNQINKI 129 Y +Y + +++ + D A RKI + F+ W + I Sbjct: 297 YYWYKYQDRRDTDLSRADLEATLRKITDLGADGFIIWGSSDDI 339 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 20.6 bits (41), Expect = 8.3 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -2 Query: 70 CLAH*NPELAW 38 CLAH E+AW Sbjct: 243 CLAHNGGEIAW 253 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 20.6 bits (41), Expect = 8.3 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -2 Query: 70 CLAH*NPELAW 38 CLAH E+AW Sbjct: 243 CLAHNGGEIAW 253 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 20.6 bits (41), Expect = 8.3 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -2 Query: 70 CLAH*NPELAW 38 CLAH E+AW Sbjct: 243 CLAHNGGEIAW 253 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 89,878 Number of Sequences: 438 Number of extensions: 1249 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 11943513 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -