SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P02_pT_B22
         (452 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.              24   0.67 
L10710-1|AAA27730.1|  382|Apis mellifera hyaluronidase protein.        21   4.7  
AY336529-1|AAQ02340.1|  712|Apis mellifera transferrin protein.        21   8.3  
AY336528-1|AAQ02339.1|  712|Apis mellifera transferrin protein.        21   8.3  
AY217097-1|AAO39761.1|  712|Apis mellifera transferrin protein.        21   8.3  

>AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.
          Length = 1946

 Score = 24.2 bits (50), Expect = 0.67
 Identities = 11/26 (42%), Positives = 15/26 (57%)
 Frame = +1

Query: 19   KKKKNFTMQVQDFNAPGRKIKSVANH 96
            KK  N++MQV  F + G  +KS   H
Sbjct: 1147 KKYTNYSMQVLAFTSGGDGVKSAPIH 1172


>L10710-1|AAA27730.1|  382|Apis mellifera hyaluronidase protein.
          Length = 382

 Score = 21.4 bits (43), Expect = 4.7
 Identities = 10/43 (23%), Positives = 19/43 (44%)
 Frame = +1

Query: 1   YXFYIRKKKKNFTMQVQDFNAPGRKIKSVANHTFLYWNQINKI 129
           Y +Y  + +++  +   D  A  RKI  +    F+ W   + I
Sbjct: 297 YYWYKYQDRRDTDLSRADLEATLRKITDLGADGFIIWGSSDDI 339


>AY336529-1|AAQ02340.1|  712|Apis mellifera transferrin protein.
          Length = 712

 Score = 20.6 bits (41), Expect = 8.3
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = -2

Query: 70  CLAH*NPELAW 38
           CLAH   E+AW
Sbjct: 243 CLAHNGGEIAW 253


>AY336528-1|AAQ02339.1|  712|Apis mellifera transferrin protein.
          Length = 712

 Score = 20.6 bits (41), Expect = 8.3
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = -2

Query: 70  CLAH*NPELAW 38
           CLAH   E+AW
Sbjct: 243 CLAHNGGEIAW 253


>AY217097-1|AAO39761.1|  712|Apis mellifera transferrin protein.
          Length = 712

 Score = 20.6 bits (41), Expect = 8.3
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = -2

Query: 70  CLAH*NPELAW 38
           CLAH   E+AW
Sbjct: 243 CLAHNGGEIAW 253


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 89,878
Number of Sequences: 438
Number of extensions: 1249
Number of successful extensions: 9
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 9
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9
length of database: 146,343
effective HSP length: 53
effective length of database: 123,129
effective search space used: 11943513
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)

- SilkBase 1999-2023 -