BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_pT_B17 (619 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY193727-1|AAO24698.1| 492|Anopheles gambiae cytochrome P450 pr... 28 0.21 AF487780-1|AAL96667.1| 490|Anopheles gambiae cytochrome P450 CY... 28 0.21 >AY193727-1|AAO24698.1| 492|Anopheles gambiae cytochrome P450 protein. Length = 492 Score = 28.3 bits (60), Expect = 0.21 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = +3 Query: 327 ARVQGSTISFSLIEVSH*PEFLANAPSEFNFAISR 431 A +TISF+L E+SH PE +A E + + R Sbjct: 301 AETSTATISFTLHELSHNPEAMAKLQQEIDEMMER 335 >AF487780-1|AAL96667.1| 490|Anopheles gambiae cytochrome P450 CYP6Z2 protein protein. Length = 490 Score = 28.3 bits (60), Expect = 0.21 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = +3 Query: 327 ARVQGSTISFSLIEVSH*PEFLANAPSEFNFAISR 431 A +TISF+L E+SH PE +A E + + R Sbjct: 301 AETSTATISFTLHELSHNPEAMAKLQQEIDEMMER 335 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 581,333 Number of Sequences: 2352 Number of extensions: 9659 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 60553008 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -