BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_pT_B14 (477 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_0701 - 23655762-23655857,23656067-23656141,23656245-236563... 29 2.6 >06_03_0701 - 23655762-23655857,23656067-23656141,23656245-23656301, 23656385-23656501,23657286-23657405,23657491-23657613, 23657967-23658056,23658184-23658309,23658809-23658901, 23658947-23659021,23659115-23659222,23659481-23659552, 23659673-23659735,23660850-23661017 Length = 460 Score = 28.7 bits (61), Expect = 2.6 Identities = 16/58 (27%), Positives = 25/58 (43%) Frame = -3 Query: 211 NILNMNIYLNSXXKIIVYLSLFRILNFFDKLFMQCKXXXXXXXFVCRQILKSFNMCRN 38 NI+ +N L KI + L L FDK+ Q K +Q++ + N C + Sbjct: 71 NIVRLNEVLAGKTKIYIILELITGGELFDKIARQGKLRENEARKYFQQLIDAINYCHS 128 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,214,372 Number of Sequences: 37544 Number of extensions: 125687 Number of successful extensions: 189 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 189 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 189 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 979080328 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -