BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_pT_B13 (659 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_0046 - 25398412-25398594,25399022-25399060,25399896-254003... 28 7.6 >02_05_0046 - 25398412-25398594,25399022-25399060,25399896-25400360, 25400758-25400816,25400920-25401748,25402554-25402898, 25402973-25403435,25403537-25403640,25403692-25403901, 25404933-25405088,25405774-25406052,25406237-25406986, 25407141-25407232,25407977-25408361,25408672-25408752, 25409196-25409354,25409399-25409506,25409604-25409666, 25409764-25409835,25409932-25410366 Length = 1758 Score = 27.9 bits (59), Expect = 7.6 Identities = 13/35 (37%), Positives = 23/35 (65%) Frame = -1 Query: 530 FINLLVHSFANFVIMI*KNLHIYVEIFF*INKTKY 426 F++L+VH+ F ++I N + V+I I+K+KY Sbjct: 1514 FVDLIVHTLKRFQLVIKVNAYDGVQIVDSIHKSKY 1548 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,300,209 Number of Sequences: 37544 Number of extensions: 146236 Number of successful extensions: 233 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 228 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 233 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1655832080 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -