BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_pT_B13 (659 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_25466| Best HMM Match : HlyIII (HMM E-Value=1.6e-22) 32 0.48 SB_23059| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.9 >SB_25466| Best HMM Match : HlyIII (HMM E-Value=1.6e-22) Length = 382 Score = 31.9 bits (69), Expect = 0.48 Identities = 14/34 (41%), Positives = 17/34 (50%) Frame = +2 Query: 35 LFCCCSQMCLHCSFXLXHRVPXVFVLHRLQSSLF 136 LFCC S+ C H F L + VF L Q+ F Sbjct: 137 LFCCLSEECRHICFYLDYAAISVFTLTAAQAFYF 170 >SB_23059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 339 Score = 28.3 bits (60), Expect = 5.9 Identities = 18/62 (29%), Positives = 32/62 (51%), Gaps = 2/62 (3%) Frame = -1 Query: 434 TKYL*MYIRNFLKLFIIIT**V--SFKTYIIVTYFALFNLNVFKTNI*SKCHIIFITCIE 261 T L + + +F LF+I++ V + T++ V + + NVF TN+ K + T +E Sbjct: 231 TAKLLLELEDFEVLFMILSFIVINNLSTFVCVVFIYYLSSNVFSTNLPQKAAQVLQTLLE 290 Query: 260 FN 255 N Sbjct: 291 EN 292 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,116,837 Number of Sequences: 59808 Number of extensions: 204919 Number of successful extensions: 426 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 329 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 403 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1693527500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -