BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_pT_B12 (788 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_01_0549 + 4082672-4082731,4083424-4083489,4083628-4083674,408... 31 1.0 03_03_0194 + 15319764-15319982,15320377-15320481,15320523-15320621 28 9.7 >07_01_0549 + 4082672-4082731,4083424-4083489,4083628-4083674, 4083757-4083802,4083905-4083985,4084105-4084147, 4084258-4084307,4084392-4084473,4084538-4084587, 4084687-4084760,4084870-4084921,4085034-4085459, 4085816-4086403 Length = 554 Score = 31.1 bits (67), Expect = 1.0 Identities = 25/85 (29%), Positives = 37/85 (43%), Gaps = 1/85 (1%) Frame = -3 Query: 768 VCVVXAQALTDEQKENLKKHRADCLSETKADEQLVNKLKTGDFKTENEPLKKYALCMLIK 589 VC+V + E +KK ++ SE + LV L D+ N L + C I Sbjct: 46 VCIVIGYCEGGDMSEAIKKANSNYFSEERLCMWLVQLLMALDYLHVNHILHRDVKCSNI- 104 Query: 588 SQLMTKDGKFK-KDVALAKVPNAED 517 +TKD + D LAKV ++D Sbjct: 105 --FLTKDQNIRLGDFGLAKVLTSDD 127 >03_03_0194 + 15319764-15319982,15320377-15320481,15320523-15320621 Length = 140 Score = 27.9 bits (59), Expect = 9.7 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = +2 Query: 293 CNILRYNHDIV*INTSELFNTNEVWNGWVGLCVYKK 400 C I HD+ I++S F + W G+C++KK Sbjct: 99 CYIYESKHDL--ISSSNKFGAKFLMGTWCGVCMWKK 132 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,340,261 Number of Sequences: 37544 Number of extensions: 358854 Number of successful extensions: 792 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 777 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 792 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2127163404 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -