BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_pT_B09 (396 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g50900.1 68418.m06310 armadillo/beta-catenin repeat family pr... 31 0.21 At2g40360.1 68415.m04977 transducin family protein / WD-40 repea... 30 0.49 At5g42620.1 68418.m05188 expressed protein 30 0.64 At1g53190.1 68414.m06028 zinc finger (C3HC4-type RING finger) fa... 29 1.5 At3g51770.1 68416.m05677 tetratricopeptide repeat (TPR)-containi... 27 3.4 At3g62150.1 68416.m06983 multidrug resistant (MDR) ABC transport... 27 4.5 At1g02840.3 68414.m00246 pre-mRNA splicing factor SF2 (SF2) / SR... 27 4.5 At1g02840.2 68414.m00244 pre-mRNA splicing factor SF2 (SF2) / SR... 27 4.5 At1g02840.1 68414.m00245 pre-mRNA splicing factor SF2 (SF2) / SR... 27 4.5 At3g52240.1 68416.m05741 expressed protein 27 6.0 >At5g50900.1 68418.m06310 armadillo/beta-catenin repeat family protein armadillo/beta-catenin-like repeats, Pfam:PF00514 Length = 555 Score = 31.5 bits (68), Expect = 0.21 Identities = 21/60 (35%), Positives = 29/60 (48%) Frame = -2 Query: 332 KRTTMKTSVIFVLIVLNLMWSGEAQEVARTYCGSHLADTLADLCFGVVKRGGAQYAPYFW 153 K ++ + IFVLI + + AQE A C ++L DL VV+ GG Q FW Sbjct: 304 KENFVEENAIFVLISMVSSGTSLAQENA-VGCLANLTSGDEDLMISVVREGGIQCLKSFW 362 >At2g40360.1 68415.m04977 transducin family protein / WD-40 repeat family protein contains 4 WD-40 repeats (PF00400); similar to block of proliferation protein Bop1 (GI:1679772) [Mus musculus] Length = 753 Score = 30.3 bits (65), Expect = 0.49 Identities = 15/42 (35%), Positives = 23/42 (54%), Gaps = 2/42 (4%) Frame = -1 Query: 360 DKDFSTKSFK--KNHNEDFSNFCINRAQPDVVR*GPGGSAYV 241 D D S+K +K KNH +D +N ++R+ P +AYV Sbjct: 656 DMDLSSKPYKTLKNHPKDITNVAVHRSYPLFASCSEDSTAYV 697 >At5g42620.1 68418.m05188 expressed protein Length = 841 Score = 29.9 bits (64), Expect = 0.64 Identities = 12/42 (28%), Positives = 24/42 (57%) Frame = -3 Query: 181 VVLSTRPTSGRKHTWDLAGNAA*WTNAVSGLAHLTFSHRTAD 56 ++++TRPT+G W +A W A++G ++ H T++ Sbjct: 241 LLVTTRPTTGNTLAWAVACERDQWGRAIAGHVNVAPRHLTSE 282 >At1g53190.1 68414.m06028 zinc finger (C3HC4-type RING finger) family protein similar to RING-H2 finger protein RHG1a GI:3822225 from [Arabidopsis thaliana]; contains Pfam profile PF00097: Zinc finger, C3HC4 type (RING finger) Length = 494 Score = 28.7 bits (61), Expect = 1.5 Identities = 14/47 (29%), Positives = 23/47 (48%), Gaps = 5/47 (10%) Frame = +2 Query: 137 PSMLSARSRARTEHHRVSP-----LRSTSRRVYPPSEIRNTYALPPG 262 PS L+ R + HH +P +R + +YP + +Y +PPG Sbjct: 246 PSQLNPRDHYYSHHHHPAPPPVQGMRGQNATLYPHTASSASYRVPPG 292 >At3g51770.1 68416.m05677 tetratricopeptide repeat (TPR)-containing protein contains Pfam profile PF00515: TPR Domain Length = 958 Score = 27.5 bits (58), Expect = 3.4 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +2 Query: 170 TEHHRVSPLRSTSRRVYPPSEIRNTYALP 256 ++H RV+ +RS S R YPP N P Sbjct: 66 SDHLRVNSVRSKSSRTYPPPTQPNAVVSP 94 >At3g62150.1 68416.m06983 multidrug resistant (MDR) ABC transporter, putative similar to multidrug-resistant protein CjMDR1 GI:14715462 from [Coptis japonica]; contains Pfam profiles PF00005: ABC transporter, PF00664: ABC transporter transmembrane region Length = 1292 Score = 27.1 bits (57), Expect = 4.5 Identities = 18/62 (29%), Positives = 30/62 (48%), Gaps = 2/62 (3%) Frame = -2 Query: 362 LIRTFLQNP--LKRTTMKTSVIFVLIVLNLMWSGEAQEVARTYCGSHLADTLADLCFGVV 189 +I+ F + P LK T ++IF+L+ + M AQ + + G L + +CF V Sbjct: 754 VIKAFFKPPEQLKSDTRFWAIIFMLLGVASMVVFPAQTIFFSIAGCKLVQRIRSMCFEKV 813 Query: 188 KR 183 R Sbjct: 814 VR 815 >At1g02840.3 68414.m00246 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 303 Score = 27.1 bits (57), Expect = 4.5 Identities = 24/62 (38%), Positives = 33/62 (53%), Gaps = 1/62 (1%) Frame = +2 Query: 59 RSTMRERQVCKAGNSIRPLRRVSREIPSMLSARSRA-RTEHHRVSPLRSTSRRVYPPSEI 235 RS R R K+ + R R VSR S +RSR+ + + R SP +STSR P S+ Sbjct: 202 RSPSRGRSYSKSRSRSRG-RSVSRS-RSRSRSRSRSPKAKSSRRSPAKSTSRSPGPRSKS 259 Query: 236 RN 241 R+ Sbjct: 260 RS 261 >At1g02840.2 68414.m00244 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 285 Score = 27.1 bits (57), Expect = 4.5 Identities = 24/62 (38%), Positives = 33/62 (53%), Gaps = 1/62 (1%) Frame = +2 Query: 59 RSTMRERQVCKAGNSIRPLRRVSREIPSMLSARSRA-RTEHHRVSPLRSTSRRVYPPSEI 235 RS R R K+ + R R VSR S +RSR+ + + R SP +STSR P S+ Sbjct: 202 RSPSRGRSYSKSRSRSRG-RSVSRS-RSRSRSRSRSPKAKSSRRSPAKSTSRSPGPRSKS 259 Query: 236 RN 241 R+ Sbjct: 260 RS 261 >At1g02840.1 68414.m00245 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 303 Score = 27.1 bits (57), Expect = 4.5 Identities = 24/62 (38%), Positives = 33/62 (53%), Gaps = 1/62 (1%) Frame = +2 Query: 59 RSTMRERQVCKAGNSIRPLRRVSREIPSMLSARSRA-RTEHHRVSPLRSTSRRVYPPSEI 235 RS R R K+ + R R VSR S +RSR+ + + R SP +STSR P S+ Sbjct: 202 RSPSRGRSYSKSRSRSRG-RSVSRS-RSRSRSRSRSPKAKSSRRSPAKSTSRSPGPRSKS 259 Query: 236 RN 241 R+ Sbjct: 260 RS 261 >At3g52240.1 68416.m05741 expressed protein Length = 680 Score = 26.6 bits (56), Expect = 6.0 Identities = 15/44 (34%), Positives = 19/44 (43%) Frame = +2 Query: 146 LSARSRARTEHHRVSPLRSTSRRVYPPSEIRNTYALPPGPHLTT 277 LS + + + H R S S P NTYALP P +T Sbjct: 435 LSLQEKVNSLHIRNPDCHSESSYPSTPGSYMNTYALPMEPAFST 478 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,500,623 Number of Sequences: 28952 Number of extensions: 172002 Number of successful extensions: 521 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 510 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 521 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 565902384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -