BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_pT_B06 (521 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1687.06c |rpl44|rpl28|60S ribosomal protein L28/L44|Schizosa... 64 2e-11 SPAC1751.01c |gti1||gluconate transporter inducer Gti1|Schizosac... 31 0.10 SPAC1142.06 |get3||GET complex ATPase subunit Get3 |Schizosaccha... 27 2.2 SPCC338.13 |cog4||Golgi transport complex subunit Cog4 |Schizosa... 26 3.9 SPBC337.12 |||human ZC3H3 homolog|Schizosaccharomyces pombe|chr ... 26 3.9 SPBC13A2.02 |||nucleoporin Nup82|Schizosaccharomyces pombe|chr 2... 25 5.2 SPBC17A3.06 |||phosphoprotein phosphatase|Schizosaccharomyces po... 25 6.8 SPCC663.01c |ekc1|SPCC777.16c|protein phosphatase regulatory sub... 25 9.0 >SPAC1687.06c |rpl44|rpl28|60S ribosomal protein L28/L44|Schizosaccharomyces pombe|chr 1|||Manual Length = 134 Score = 63.7 bits (148), Expect = 2e-11 Identities = 42/113 (37%), Positives = 61/113 (53%), Gaps = 3/113 (2%) Frame = -3 Query: 429 VKMSSSLNWMIIRNNNAFLVKKRNIKK-PFSKEPNNVTNLHSFRYNGLIHKKAVGVVENP 253 + +S+ L W +IR+NN FLVK+ F++EP NV+ ++ R++GL + KAVGV N Sbjct: 1 MSVSNDLIWQVIRDNNRFLVKRPEFGGIQFNREPVNVSGKNAQRFSGLCNDKAVGVQANS 60 Query: 252 DRKGFTVVYKKAKATRKPAKNLIRRPFKAGA-RRSLYK-VKRLLKANHYRTDL 100 R + K +KPAK L R+ A A R YK + + YR DL Sbjct: 61 PRGVVLITKTNPKNAQKPAK-LFRKDVIANASSRKTYKSIAGRIGRTGYRDDL 112 Score = 24.6 bits (51), Expect = 9.0 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -1 Query: 95 KATLRRASAILRSQRP 48 K ++ RASAIL SQRP Sbjct: 114 KVSVARASAILSSQRP 129 >SPAC1751.01c |gti1||gluconate transporter inducer Gti1|Schizosaccharomyces pombe|chr 1|||Manual Length = 720 Score = 31.1 bits (67), Expect = 0.10 Identities = 15/49 (30%), Positives = 22/49 (44%) Frame = +1 Query: 226 VHYCESLPVRVLHDTNSFLVNQAVVPEGVEVSHIVRLLAERLFDIALLH 372 +HYC S + LHDT LV G + S +++ + D L H Sbjct: 251 IHYCSSSSLSYLHDTERALVGSLTDSYGFKKSGLIKKTISLMIDGRLHH 299 >SPAC1142.06 |get3||GET complex ATPase subunit Get3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 329 Score = 26.6 bits (56), Expect = 2.2 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = +3 Query: 450 PNTTCSQCVRRQK 488 PNTTC QC+ R+K Sbjct: 264 PNTTCPQCMARRK 276 >SPCC338.13 |cog4||Golgi transport complex subunit Cog4 |Schizosaccharomyces pombe|chr 3|||Manual Length = 738 Score = 25.8 bits (54), Expect = 3.9 Identities = 13/37 (35%), Positives = 18/37 (48%) Frame = +2 Query: 365 FFTRNALLLRMIIQFSDDDIFTV*TYFYTKHNVLTMC 475 FFT ++L + S I Y Y HN+LT+C Sbjct: 449 FFTVSSLFFTRFVNESLIPILRNDYYVYLSHNLLTVC 485 >SPBC337.12 |||human ZC3H3 homolog|Schizosaccharomyces pombe|chr 2|||Manual Length = 377 Score = 25.8 bits (54), Expect = 3.9 Identities = 18/69 (26%), Positives = 28/69 (40%), Gaps = 1/69 (1%) Frame = -3 Query: 390 NNNAFLVKKRNIKKPFSKEPNNVTNLHSFRYNGLIHK-KAVGVVENPDRKGFTVVYKKAK 214 NN ++L+KK+ K P+ V + NG+ K A V P RK + + Sbjct: 185 NNKSYLLKKKRFLKEVGNSPSAV-YCRYYNANGICGKGAACRFVHEPTRKTICPKFLNGR 243 Query: 213 ATRKPAKNL 187 + NL Sbjct: 244 CNKAEDCNL 252 >SPBC13A2.02 |||nucleoporin Nup82|Schizosaccharomyces pombe|chr 2|||Manual Length = 803 Score = 25.4 bits (53), Expect = 5.2 Identities = 10/36 (27%), Positives = 21/36 (58%) Frame = -3 Query: 417 SSLNWMIIRNNNAFLVKKRNIKKPFSKEPNNVTNLH 310 S ++ + + NNN ++V + +I+ P+S + LH Sbjct: 415 SQVHSLYLSNNNPYMVLQPDIQSPYSLIAYHANGLH 450 >SPBC17A3.06 |||phosphoprotein phosphatase|Schizosaccharomyces pombe|chr 2|||Manual Length = 330 Score = 25.0 bits (52), Expect = 6.8 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = -2 Query: 286 SQESCWCRGEP*QEGIHSSVQESKGY 209 S +S W +P + IHSSVQE++G+ Sbjct: 2 SNKSAW---QPQFDEIHSSVQEAEGF 24 >SPCC663.01c |ekc1|SPCC777.16c|protein phosphatase regulatory subunit Ekc1 |Schizosaccharomyces pombe|chr 3|||Manual Length = 838 Score = 24.6 bits (51), Expect = 9.0 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +2 Query: 269 PTAFL*IKPLYLKEWRLVTLFGSLLN 346 PT+F IKPL + +R+ L+ LL+ Sbjct: 347 PTSFGKIKPLGFERFRICELYAELLH 372 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,083,896 Number of Sequences: 5004 Number of extensions: 40183 Number of successful extensions: 127 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 124 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 126 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 212331630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -