BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_pT_B06 (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. 26 0.88 U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. 26 0.88 AJ276487-1|CAB90819.1| 375|Anopheles gambiae serine protease pr... 25 1.5 AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein p... 25 2.0 U89803-1|AAD03794.1| 250|Anopheles gambiae Tc1-like transposase... 24 3.6 >U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 25.8 bits (54), Expect = 0.88 Identities = 14/50 (28%), Positives = 23/50 (46%) Frame = -3 Query: 252 DRKGFTVVYKKAKATRKPAKNLIRRPFKAGARRSLYKVKRLLKANHYRTD 103 DR Y++ K +K A + +RP A + L ++K N Y T+ Sbjct: 476 DRPSSGPRYRRTKQPKKRADSEEKRPRTAFSNAQLQRLKNEFNENRYLTE 525 >U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 25.8 bits (54), Expect = 0.88 Identities = 14/50 (28%), Positives = 23/50 (46%) Frame = -3 Query: 252 DRKGFTVVYKKAKATRKPAKNLIRRPFKAGARRSLYKVKRLLKANHYRTD 103 DR Y++ K +K A + +RP A + L ++K N Y T+ Sbjct: 476 DRPSSGPRYRRTKQPKKRADSEEKRPRTAFSNAQLQRLKNEFNENRYLTE 525 >AJ276487-1|CAB90819.1| 375|Anopheles gambiae serine protease protein. Length = 375 Score = 25.0 bits (52), Expect = 1.5 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +3 Query: 435 KPISTPNTTCSQCVR 479 KP +TPN T +CVR Sbjct: 28 KPCTTPNGTAGRCVR 42 >AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein protein. Length = 724 Score = 24.6 bits (51), Expect = 2.0 Identities = 16/46 (34%), Positives = 22/46 (47%) Frame = -2 Query: 418 VVTELDDHPQQQCIPCEEAQYQKAVQQGAEQCD*PPLLQVQRLDSQ 281 V +L QQQ P ++ Q Q+ QQ + PP L+ QR Q Sbjct: 265 VPPQLRQQRQQQQRPRQQQQQQQQQQQQQGERYVPPQLRQQRQQQQ 310 >U89803-1|AAD03794.1| 250|Anopheles gambiae Tc1-like transposase protein. Length = 250 Score = 23.8 bits (49), Expect = 3.6 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 2/38 (5%) Frame = +2 Query: 68 WLKHDEG*PXHKS--VR*WLAFNNLFTLYSDLLAPALN 175 W+ + H S V+ WLA NN+ T+ L+P LN Sbjct: 149 WMFMQDNDSKHTSGTVQTWLADNNVKTMKWPALSPDLN 186 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 541,639 Number of Sequences: 2352 Number of extensions: 11188 Number of successful extensions: 61 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 61 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 61 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -