BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_pT_B05 (720 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 prot... 24 1.4 AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle pr... 23 1.9 AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory recept... 23 2.5 >DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 protein. Length = 496 Score = 23.8 bits (49), Expect = 1.4 Identities = 15/54 (27%), Positives = 28/54 (51%) Frame = +3 Query: 342 VTASWNKMDVSGARRAAPLDAIVRQHNTQNYFKWKHCKKT*IHPLWFLIPHLIH 503 + AS+ + SGA +A D +V T + ++W + + T H +L H+I+ Sbjct: 5 LVASFLLVYFSGALVSATTDKVVCYWGTWSTYRWGNGRFTVDHIDPYLCTHIIY 58 >AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle protein. Length = 361 Score = 23.4 bits (48), Expect = 1.9 Identities = 9/32 (28%), Positives = 18/32 (56%) Frame = +2 Query: 137 IYDWYINKLEEQSKLLNCKTFRCAVRGILCEL 232 I D +++ + + LNC + A+ +LCE+ Sbjct: 50 ITDQSLDEAQARKHTLNCHRMKPALFSVLCEI 81 >AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory receptor candidate 59 protein. Length = 489 Score = 23.0 bits (47), Expect = 2.5 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +3 Query: 132 SSYMTGISTNLRNSQSC*IVRHLDVLCAGYYAN 230 ++YM I+TNLR +Q IV L L AN Sbjct: 55 TAYMVYITTNLRITQKLSIVTQLADLIFSASAN 87 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 181,369 Number of Sequences: 336 Number of extensions: 4254 Number of successful extensions: 9 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19155320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -