BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_pT_B05 (720 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. 25 2.4 AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. 25 2.4 >AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. Length = 1132 Score = 25.0 bits (52), Expect = 2.4 Identities = 16/48 (33%), Positives = 23/48 (47%) Frame = -1 Query: 594 DNKQLACKSFR*HVYCNPNFTFSRALPSYLHVSGGVLETTVDGFRFFY 451 D +QL ++F + N F+ P+Y +LE VD FRF Y Sbjct: 159 DQEQLQTQTFT--YVTSSNEAFAAPEPNYSEPHLVILEQPVDKFRFRY 204 >AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. Length = 1009 Score = 25.0 bits (52), Expect = 2.4 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +2 Query: 5 TCYQMRH*NLLTLGSGCASHGHN 73 TCY + L LGSG A HGH+ Sbjct: 969 TCYDFKP-KLGQLGSGGARHGHS 990 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 790,717 Number of Sequences: 2352 Number of extensions: 16678 Number of successful extensions: 73 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 72 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 73 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 73181328 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -