BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_pT_B05 (720 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC039004-1|AAH39004.1| 612|Homo sapiens carnitine O-octanoyltra... 31 4.1 AF168793-1|AAF03234.1| 612|Homo sapiens peroxisomal carnitine o... 31 4.1 AF073770-1|AAD41654.1| 612|Homo sapiens carnitine octanoyltrans... 31 4.1 AY210418-1|AAO34701.1| 3487|Homo sapiens CUB and sushi multiple ... 30 9.6 AB212622-1|BAD97692.1| 3631|Homo sapiens CSMD2 protein protein. 30 9.6 >BC039004-1|AAH39004.1| 612|Homo sapiens carnitine O-octanoyltransferase protein. Length = 612 Score = 31.1 bits (67), Expect = 4.1 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = -1 Query: 540 NFTFSRALPSYLHVSGGVLETTVDGFRFFYNV 445 NF S +L YL V G V+ +G+ FFY++ Sbjct: 538 NFVLSTSLVGYLRVQGVVVPMVHNGYGFFYHI 569 >AF168793-1|AAF03234.1| 612|Homo sapiens peroxisomal carnitine octanoyltransferase protein. Length = 612 Score = 31.1 bits (67), Expect = 4.1 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = -1 Query: 540 NFTFSRALPSYLHVSGGVLETTVDGFRFFYNV 445 NF S +L YL V G V+ +G+ FFY++ Sbjct: 538 NFVLSTSLVGYLRVQGVVVPMVHNGYGFFYHI 569 >AF073770-1|AAD41654.1| 612|Homo sapiens carnitine octanoyltransferase protein. Length = 612 Score = 31.1 bits (67), Expect = 4.1 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = -1 Query: 540 NFTFSRALPSYLHVSGGVLETTVDGFRFFYNV 445 NF S +L YL V G V+ +G+ FFY++ Sbjct: 538 NFVLSTSLVGYLRVQGVVVPMVHNGYGFFYHI 569 >AY210418-1|AAO34701.1| 3487|Homo sapiens CUB and sushi multiple domains 2 protein. Length = 3487 Score = 29.9 bits (64), Expect = 9.6 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = -1 Query: 549 CNPNFTFSRALPSYLHVSGGVLE 481 C PNF +SRALPS + GG ++ Sbjct: 907 CEPNFQWSRALPSCEALCGGFIQ 929 >AB212622-1|BAD97692.1| 3631|Homo sapiens CSMD2 protein protein. Length = 3631 Score = 29.9 bits (64), Expect = 9.6 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = -1 Query: 549 CNPNFTFSRALPSYLHVSGGVLE 481 C PNF +SRALPS + GG ++ Sbjct: 947 CEPNFQWSRALPSCEALCGGFIQ 969 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 108,158,121 Number of Sequences: 237096 Number of extensions: 2486442 Number of successful extensions: 4531 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 4197 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4531 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8455186714 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -