BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_pT_B02 (440 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT014650-1|AAT27274.1| 113|Drosophila melanogaster RE22403p pro... 90 1e-18 AE013599-1949|AAF58210.1| 113|Drosophila melanogaster CG12859-P... 90 1e-18 AY071583-1|AAL49205.1| 495|Drosophila melanogaster RE63964p pro... 29 2.8 AE014298-2106|AAF48426.1| 495|Drosophila melanogaster CG9081-PA... 29 2.8 >BT014650-1|AAT27274.1| 113|Drosophila melanogaster RE22403p protein. Length = 113 Score = 89.8 bits (213), Expect = 1e-18 Identities = 43/109 (39%), Positives = 70/109 (64%), Gaps = 1/109 (0%) Frame = -1 Query: 353 LSDAELNLIKTQASRRAEMRREFLKQRTNPWKNAS-EAGYVFDTALQRFLSMKVTQFEYF 177 LS+ E IK + ++R+EFLKQ +NP+++A+ E G VFD L RF +M+V+ +E+F Sbjct: 3 LSNEEQEFIKRKHEATLKLRQEFLKQSSNPYRHATGEGGTVFDAGLARFQAMRVSNYEHF 62 Query: 176 TVNKRTSLFGFFVIVVPMFTFGTLIWNERTQREQKIRSGELRYKDRRFK 30 ++ G F +V+P+ + + ER RE+K R+G++ YKDR+FK Sbjct: 63 KPTGKSFRTGLFAVVLPIALYAWALKAERDGREEKYRTGQVAYKDRQFK 111 >AE013599-1949|AAF58210.1| 113|Drosophila melanogaster CG12859-PA protein. Length = 113 Score = 89.8 bits (213), Expect = 1e-18 Identities = 43/109 (39%), Positives = 70/109 (64%), Gaps = 1/109 (0%) Frame = -1 Query: 353 LSDAELNLIKTQASRRAEMRREFLKQRTNPWKNAS-EAGYVFDTALQRFLSMKVTQFEYF 177 LS+ E IK + ++R+EFLKQ +NP+++A+ E G VFD L RF +M+V+ +E+F Sbjct: 3 LSNEEQEFIKRKHEATLKLRQEFLKQSSNPYRHATGEGGTVFDAGLARFQAMRVSNYEHF 62 Query: 176 TVNKRTSLFGFFVIVVPMFTFGTLIWNERTQREQKIRSGELRYKDRRFK 30 ++ G F +V+P+ + + ER RE+K R+G++ YKDR+FK Sbjct: 63 KPTGKSFRTGLFAVVLPIALYAWALKAERDGREEKYRTGQVAYKDRQFK 111 >AY071583-1|AAL49205.1| 495|Drosophila melanogaster RE63964p protein. Length = 495 Score = 29.1 bits (62), Expect = 2.8 Identities = 19/56 (33%), Positives = 27/56 (48%), Gaps = 1/56 (1%) Frame = -1 Query: 347 DAELNLIKTQASRRAEMRREFLKQRTNPWKNASEAGYVFDTALQRFLSM-KVTQFE 183 +A L ++ + +R +RRE L Q N WK +E V FL M +TQ E Sbjct: 232 EAALKVLHDETNRVIRLRREQLIQERNEWKPEAEQDDVGAKRRLAFLDMLLLTQME 287 >AE014298-2106|AAF48426.1| 495|Drosophila melanogaster CG9081-PA protein. Length = 495 Score = 29.1 bits (62), Expect = 2.8 Identities = 19/56 (33%), Positives = 27/56 (48%), Gaps = 1/56 (1%) Frame = -1 Query: 347 DAELNLIKTQASRRAEMRREFLKQRTNPWKNASEAGYVFDTALQRFLSM-KVTQFE 183 +A L ++ + +R +RRE L Q N WK +E V FL M +TQ E Sbjct: 232 EAALKVLHDETNRVIRLRREQLIQERNEWKPEAEQDDVGAKRRLAFLDMLLLTQME 287 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,834,148 Number of Sequences: 53049 Number of extensions: 366279 Number of successful extensions: 985 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 938 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 983 length of database: 24,988,368 effective HSP length: 78 effective length of database: 20,850,546 effective search space used: 1417837128 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -