BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_pT_B02 (440 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g50580.1 68414.m05679 glycosyltransferase family protein simi... 28 2.4 At1g64910.1 68414.m07358 glycosyltransferase family protein cont... 28 3.2 At1g08140.1 68414.m00896 cation/hydrogen exchanger (CHX6a) Note:... 27 4.2 At1g22620.1 68414.m02824 phosphoinositide phosphatase family pro... 27 5.6 At5g44510.1 68418.m05453 disease resistance protein (TIR-NBS-LRR... 27 7.4 At2g41890.1 68415.m05181 curculin-like (mannose-binding) lectin ... 27 7.4 At1g69220.2 68414.m07926 serine/threonine protein kinase, putati... 27 7.4 At5g63760.2 68418.m08003 IBR domain-containing protein contains ... 26 9.8 At5g63760.1 68418.m08002 IBR domain-containing protein contains ... 26 9.8 At5g53990.1 68418.m06716 glycosyltransferase family protein cont... 26 9.8 At2g40160.1 68415.m04939 expressed protein 26 9.8 >At1g50580.1 68414.m05679 glycosyltransferase family protein similar to UDP rhamnose: anthocyanidin-3-glucoside rhamnosyltransferase GB:CAA81057 GI:397567 from [Petunia x hybrida]; contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 448 Score = 28.3 bits (60), Expect = 2.4 Identities = 16/55 (29%), Positives = 23/55 (41%) Frame = -1 Query: 290 EFLKQRTNPWKNASEAGYVFDTALQRFLSMKVTQFEYFTVNKRTSLFGFFVIVVP 126 +FL+ R N W N E G V A + QF+ F + F + V+P Sbjct: 236 KFLEDRWNHWLNGFEPGSVVFCAFGTQFFFEKDQFQEFCLGMELMGLPFLISVMP 290 >At1g64910.1 68414.m07358 glycosyltransferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 447 Score = 27.9 bits (59), Expect = 3.2 Identities = 16/53 (30%), Positives = 25/53 (47%) Frame = -1 Query: 284 LKQRTNPWKNASEAGYVFDTALQRFLSMKVTQFEYFTVNKRTSLFGFFVIVVP 126 L+ R + W N E G V AL ++++ QF+ + + FFV V P Sbjct: 237 LEDRWSHWLNGFEQGSVVFCALGSQVTLEKDQFQELCLGIELTGLPFFVAVTP 289 >At1g08140.1 68414.m00896 cation/hydrogen exchanger (CHX6a) Note: CHX6a and CHX6b were originally 1 gene but were split pased on alignments with other family members; may be a pseudogene and requires futher investigation; monovalent cation:proton antiporter family 2 (CPA2) member, PMID:11500563 Length = 818 Score = 27.5 bits (58), Expect = 4.2 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = -1 Query: 179 FTVNKRTSLFGFFVIVVPMFTFGTLIWNERTQR 81 F KR+S+ GF +++P+ G+L + R +R Sbjct: 149 FRTEKRSSVIGFITVIIPLIC-GSLTFRYRERR 180 >At1g22620.1 68414.m02824 phosphoinositide phosphatase family protein contains similarity to phosphoinositide phosphatase SAC1 [Rattus norvegicus] gi|11095248|gb|AAG29810; contains Pfam domain, PF02383: SacI homology domain; identical to cDNA SAC domain protein 1 (SAC1) SAC1-FRA7 allele, GI:31415718 Length = 912 Score = 27.1 bits (57), Expect = 5.6 Identities = 16/32 (50%), Positives = 18/32 (56%), Gaps = 2/32 (6%) Frame = -1 Query: 374 NMANNYGLSDAELNLIKTQASRRAEM--RREF 285 ++ N YG LNLIKT R EM RREF Sbjct: 347 DLVNRYGNPIIVLNLIKTVEKRPREMVLRREF 378 >At5g44510.1 68418.m05453 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1187 Score = 26.6 bits (56), Expect = 7.4 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = +3 Query: 216 LQCCVENITSLRSVFPGVCSLFQELPS 296 L + NIT+L+S++ CS +ELPS Sbjct: 887 LPSSIWNITNLQSLYLNGCSSLKELPS 913 >At2g41890.1 68415.m05181 curculin-like (mannose-binding) lectin family protein / PAN domain-containing protein contains Pfam profiles: PF01453 lectin (probable mannose binding), PF00024 PAN domain Length = 764 Score = 26.6 bits (56), Expect = 7.4 Identities = 15/51 (29%), Positives = 24/51 (47%), Gaps = 1/51 (1%) Frame = +3 Query: 87 RSLVPYQGTKCKHGYNNNK-KSKQTSSLVYGKIFKLCYFHGQKPLQCCVEN 236 + LVPYQ CK G+N K K+ + + + Q+ + C+EN Sbjct: 322 KCLVPYQKPGCKSGFNMVKFKNLELYGIYPANDSVISQISSQRCKKLCLEN 372 >At1g69220.2 68414.m07926 serine/threonine protein kinase, putative identical to serine/threonine kinase [Arabidopsis thaliana] gi|2352084|gb|AAB68776 Length = 809 Score = 26.6 bits (56), Expect = 7.4 Identities = 13/47 (27%), Positives = 20/47 (42%) Frame = +3 Query: 48 VTELSTANLLFTLRSLVPYQGTKCKHGYNNNKKSKQTSSLVYGKIFK 188 V + +N R L P + HG +N K +Q YG ++K Sbjct: 192 VASMQKSNFGGKTRKLDPSSSSSKLHGEDNRKMQQQNRKGSYGSVYK 238 >At5g63760.2 68418.m08003 IBR domain-containing protein contains similarity to Swiss-Prot:Q94981 ariadne-1 protein (Ari-1) [Drosophila melanogaster] and Pfam:PF01485 IBR domain Length = 452 Score = 26.2 bits (55), Expect = 9.8 Identities = 15/48 (31%), Positives = 25/48 (52%) Frame = +1 Query: 70 IFCSRCVLSFHIKVPNVNMGTTITKNPNKLVRLFTVKYSNCVTFMDRN 213 IFC RC+L H V N ++++ KL+ V + V+++D N Sbjct: 159 IFCWRCMLESHRPVTCNNASDWLSRDLEKLIE--EVDKPSTVSWIDAN 204 >At5g63760.1 68418.m08002 IBR domain-containing protein contains similarity to Swiss-Prot:Q94981 ariadne-1 protein (Ari-1) [Drosophila melanogaster] and Pfam:PF01485 IBR domain Length = 452 Score = 26.2 bits (55), Expect = 9.8 Identities = 15/48 (31%), Positives = 25/48 (52%) Frame = +1 Query: 70 IFCSRCVLSFHIKVPNVNMGTTITKNPNKLVRLFTVKYSNCVTFMDRN 213 IFC RC+L H V N ++++ KL+ V + V+++D N Sbjct: 159 IFCWRCMLESHRPVTCNNASDWLSRDLEKLIE--EVDKPSTVSWIDAN 204 >At5g53990.1 68418.m06716 glycosyltransferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 447 Score = 26.2 bits (55), Expect = 9.8 Identities = 15/53 (28%), Positives = 24/53 (45%) Frame = -1 Query: 284 LKQRTNPWKNASEAGYVFDTALQRFLSMKVTQFEYFTVNKRTSLFGFFVIVVP 126 L+ R N W N + G V AL ++++ QF+ + + F V V P Sbjct: 237 LEDRWNHWLNQFKPGSVIYCALGSQITLEKDQFQELCLGMELTGLPFLVAVKP 289 >At2g40160.1 68415.m04939 expressed protein Length = 427 Score = 26.2 bits (55), Expect = 9.8 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = -1 Query: 158 SLFGFFVIVVPMFTFGTLIWNERTQR 81 SL F VI++P+F G ++NE+ R Sbjct: 14 SLLYFAVILLPVFLLGCYLYNEKQLR 39 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,286,101 Number of Sequences: 28952 Number of extensions: 183209 Number of successful extensions: 528 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 504 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 528 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 702840360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -