BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_pT_A22 (730 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EU019709-1|ABU25221.1| 540|Tribolium castaneum aspartate 1-deca... 23 2.5 EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive pep... 22 5.8 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 22 5.8 EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggeri... 21 7.7 >EU019709-1|ABU25221.1| 540|Tribolium castaneum aspartate 1-decarboxylase protein. Length = 540 Score = 23.0 bits (47), Expect = 2.5 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = -1 Query: 295 VDSYGDRKTWGSNGSSEKRHTWSLYPVKVGDQQLFLIENR 176 VD YG W ++ + +T+ + PV V +++ L E R Sbjct: 142 VDPYGLVAQWATDALNPSVYTYEVSPVFVLMEEVVLREMR 181 >EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive peptide receptor 2 protein. Length = 354 Score = 21.8 bits (44), Expect = 5.8 Identities = 11/45 (24%), Positives = 22/45 (48%), Gaps = 6/45 (13%) Frame = -1 Query: 400 SHHVSWQLISLWEDNNVIFKILN------TEYEMYLKLDVNVDSY 284 S ++W++ W NV+ KI+ T Y+ + +++D Y Sbjct: 101 STDIAWRITVAWYAGNVLCKIIRFLQAVVTYSSTYVLVALSIDRY 145 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 21.8 bits (44), Expect = 5.8 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +2 Query: 185 DEEQLLVSHLYRV*RPGVSLLTGTIRSPGLP 277 DE++ ++ + RV +P L +RSP P Sbjct: 336 DEKKYILQEVVRVKKPHYELNMVEVRSPVTP 366 >EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggering hormone receptorisoform B protein. Length = 451 Score = 21.4 bits (43), Expect = 7.7 Identities = 8/29 (27%), Positives = 15/29 (51%) Frame = +3 Query: 363 SQREMSCQLTWWLV*SFPSPQVRRSLYSP 449 ++ + C L W++ F SP + + Y P Sbjct: 185 TRASLICLLAWFIAALFTSPILAITQYGP 213 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 154,653 Number of Sequences: 336 Number of extensions: 3347 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19467635 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -