BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_pT_A22 (730 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g15640.1 68415.m01791 F-box family protein contains Pfam PF00... 34 0.11 At1g30760.1 68414.m03761 FAD-binding domain-containing protein s... 30 1.8 At5g01280.1 68418.m00037 expressed protein 29 3.2 At1g76070.1 68414.m08834 expressed protein 29 3.2 At1g47410.1 68414.m05250 expressed protein identical to hypothet... 28 5.5 At1g28300.1 68414.m03473 transcriptional factor B3 family protei... 28 5.5 At4g25790.1 68417.m03711 allergen V5/Tpx-1-related family protei... 28 7.3 At2g32040.1 68415.m03914 integral membrane transporter family pr... 28 7.3 At1g19360.1 68414.m02409 expressed protein 28 7.3 At3g30230.1 68416.m03820 myosin heavy chain-related similar to M... 27 9.6 >At2g15640.1 68415.m01791 F-box family protein contains Pfam PF00646: F-box domain; contains TIGRFAM TIGR01640 : F-box protein interaction domain Length = 426 Score = 33.9 bits (74), Expect = 0.11 Identities = 15/59 (25%), Positives = 29/59 (49%) Frame = -1 Query: 367 WEDNNVIFKILNTEYEMYLKLDVNVDSYGDRKTWGSNGSSEKRHTWSLYPVKVGDQQLF 191 WED+ I+K+ ++ + Y++ ++N D + + W K+ WS Y D + F Sbjct: 278 WEDDVDIYKLYYSDVDEYVEYNINDDDINELRVWVL--EDVKKQQWSKYAYTWTDDRFF 334 >At1g30760.1 68414.m03761 FAD-binding domain-containing protein similar to SP|P30986 reticuline oxidase precursor (Berberine-bridge-forming enzyme) (BBE) (Tetrahydroprotoberberine synthase) [Eschscholzia californica]; contains PF01565 FAD binding domain Length = 534 Score = 29.9 bits (64), Expect = 1.8 Identities = 15/56 (26%), Positives = 24/56 (42%), Gaps = 1/56 (1%) Frame = -1 Query: 424 WGDGKDYTSHHVSWQLISLWEDNNVIFKILNTEYEMYLKLDVNVDSYG-DRKTWGS 260 W DGK + H+ W + K + Y Y LD+ ++ G D + WG+ Sbjct: 445 WQDGKTSEAKHMGWMREMYSYMEQYVSKSPRSAYVNYRDLDLGMNGKGSDAREWGN 500 >At5g01280.1 68418.m00037 expressed protein Length = 460 Score = 29.1 bits (62), Expect = 3.2 Identities = 25/85 (29%), Positives = 36/85 (42%), Gaps = 2/85 (2%) Frame = -2 Query: 600 PCRSRTSCGTRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PG 421 P TS TRAT TSS TS S S ++ + ++ +T+ + ST G Sbjct: 114 PTSRATSTTTRATLTSSSTTSSTRSWSRPSSSSGTGTSRVTLTAARATRPTTSTDQQTTG 173 Query: 420 ETEKT--TPATMSAGNSSLFGKTTT 352 T MSA NS +++T Sbjct: 174 SATSTRSNNRPMSAPNSKPGSRSST 198 >At1g76070.1 68414.m08834 expressed protein Length = 272 Score = 29.1 bits (62), Expect = 3.2 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = +2 Query: 533 AREVIFDDVLVALVPQLVRERHGVLDALRDEPRDDVATDVGAL 661 A ++ F +V LVP R R DA+ DEP + +G + Sbjct: 52 ANKMFFSGPMVPLVPNAARVRRNKSDAVWDEPTSPKVSCIGQI 94 >At1g47410.1 68414.m05250 expressed protein identical to hypothetical protein GB:AAD46041 GI:5668815 from (Arabidopsis thaliana) Length = 189 Score = 28.3 bits (60), Expect = 5.5 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +3 Query: 39 EGCHCHGWIMKP*YSGLSATVPLLPHTRRSPYES 140 E CHC GW GL LLP +SP ES Sbjct: 146 EFCHCQGWPF-----GLGRKAALLPPLPKSPAES 174 >At1g28300.1 68414.m03473 transcriptional factor B3 family protein / leafy cotyledon 2 (LEC2) nearly identical to LEAFY COTYLEDON 2 [Arabidopsis thaliana] GI:15987516; contains Pfam profile PF02362: B3 DNA binding domain Length = 363 Score = 28.3 bits (60), Expect = 5.5 Identities = 13/46 (28%), Positives = 24/46 (52%) Frame = -3 Query: 206 RPTAVPHREPGVPAGTEAGRERGLIRGPPCVGEQRDSRRQPRVLRL 69 +P + P +P T+ G E G + G PC+ ++R PR+ ++ Sbjct: 63 QPVYLSECYPQIPV-TQTGSEFGSLVGNPCLWQERGGFLDPRMTKM 107 >At4g25790.1 68417.m03711 allergen V5/Tpx-1-related family protein similar to SP|Q40374 Pathogenesis-related protein PR-1 precursor {Medicago truncatula}; contains Pfam profile PF00188: SCP-like extracellular protein Length = 210 Score = 27.9 bits (59), Expect = 7.3 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = -1 Query: 463 LDANVGEYNDRLTWGDGKDYTS 398 L + G Y + L WG G D+TS Sbjct: 117 LTHSTGPYGENLFWGSGSDFTS 138 >At2g32040.1 68415.m03914 integral membrane transporter family protein contains 9 transmembrane domains; contains Pfam PF03092: BT1 family; contains TIGRFAMS TIGR00788: folate/biopterin transporter; similar to high affinity folic acid/methotrexate transporter 5 (GI:21898554) [Leishmania tarentolae] Length = 560 Score = 27.9 bits (59), Expect = 7.3 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +3 Query: 60 WIMKP*YSGLSATVPLLPHTRRS 128 W++KP Y +S +VPL + RRS Sbjct: 173 WLVKPLYGFISDSVPLFGYRRRS 195 >At1g19360.1 68414.m02409 expressed protein Length = 428 Score = 27.9 bits (59), Expect = 7.3 Identities = 12/48 (25%), Positives = 29/48 (60%), Gaps = 2/48 (4%) Frame = -1 Query: 442 YNDRLTWGDGKDYTSHHVSWQLISLWE--DNNVIFKILNTEYEMYLKL 305 +N+ L + +YT+ H S +++ ++E ++ V+FK + +E+ K+ Sbjct: 341 FNEELFYPSHPEYTALHASKRVMDMYEFMNSKVLFKTVRKNHELKKKV 388 >At3g30230.1 68416.m03820 myosin heavy chain-related similar to Myosin heavy chain, non-muscle (Zipper protein) (Myosin II)(SP:Q99323) {Drosophila melanogaster} Length = 527 Score = 27.5 bits (58), Expect = 9.6 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +1 Query: 85 GCRRLSRCSPTQGGPRMSPRSRPASVP 165 GC SP + PR SPR+R +S P Sbjct: 162 GCSPRRNLSPHRNSPRYSPRNRLSSKP 188 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,742,242 Number of Sequences: 28952 Number of extensions: 304590 Number of successful extensions: 959 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 928 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 958 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1594686376 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -