BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_pT_A21 (628 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z75529-5|CAA99784.1| 610|Caenorhabditis elegans Hypothetical pr... 28 4.8 AF098996-6|AAC68709.1| 481|Caenorhabditis elegans Hypothetical ... 28 4.8 >Z75529-5|CAA99784.1| 610|Caenorhabditis elegans Hypothetical protein C44H9.6 protein. Length = 610 Score = 28.3 bits (60), Expect = 4.8 Identities = 14/40 (35%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Frame = +3 Query: 87 LAPT-LSKNHLHXSXQRGHVFCTQTMADFSSDMSKLTAVN 203 L PT LSK H + + Q GH FC + + + M + N Sbjct: 60 LIPTNLSKGHRYTAQQNGHSFCHSYLQNITETMGADESTN 99 >AF098996-6|AAC68709.1| 481|Caenorhabditis elegans Hypothetical protein T11F1.2 protein. Length = 481 Score = 28.3 bits (60), Expect = 4.8 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +3 Query: 141 VFCTQTMADFSSDMSKLTAVNSCHSPMNFDH 233 +F + MADF+ D+ KLT + C F++ Sbjct: 44 LFLSCVMADFNYDLEKLTLTHKCDPQCTFNY 74 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,584,763 Number of Sequences: 27780 Number of extensions: 205313 Number of successful extensions: 287 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 283 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 287 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1374536540 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -