BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_pT_A20 (644 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC15A10.06 |||CPA1 sodium ion/proton antiporter|Schizosaccharo... 26 4.0 SPAC1B3.10c |||SEL1 repeat protein, unknown biological role|Schi... 25 7.1 SPAC31A2.05c |mis4||cohesin loading factor Mis4|Schizosaccharomy... 25 7.1 >SPAC15A10.06 |||CPA1 sodium ion/proton antiporter|Schizosaccharomyces pombe|chr 1|||Manual Length = 569 Score = 26.2 bits (55), Expect = 4.0 Identities = 12/43 (27%), Positives = 20/43 (46%) Frame = -1 Query: 146 LLKYLKFFHSQFCQQN*MCKKSFCWLTVYFHVIILXIYKAVVS 18 L+ Y +F S C + + FC +T+ + YKA +S Sbjct: 273 LMAYTSYFFSNGCHMSGVVSLLFCGITLKHYAFFNMSYKAKLS 315 >SPAC1B3.10c |||SEL1 repeat protein, unknown biological role|Schizosaccharomyces pombe|chr 1|||Manual Length = 680 Score = 25.4 bits (53), Expect = 7.1 Identities = 9/20 (45%), Positives = 16/20 (80%) Frame = -3 Query: 174 HTVDENQFLIVEVFKVFSFS 115 + +DEN+FLI VF+ F+++ Sbjct: 520 YLMDENKFLINSVFRYFNYT 539 >SPAC31A2.05c |mis4||cohesin loading factor Mis4|Schizosaccharomyces pombe|chr 1|||Manual Length = 1583 Score = 25.4 bits (53), Expect = 7.1 Identities = 29/110 (26%), Positives = 50/110 (45%), Gaps = 1/110 (0%) Frame = +3 Query: 108 AKLRMKKL*ILQQLKTDSHPLYVSCIPQQK*FLLITLN-KSPYIYYFVLFIFHSKLLSLF 284 A LR K L I+ Q+KT P + P+ ++ N +S + VL + + +++ Sbjct: 789 ASLRTKCLRIINQMKTI--PSILRTHPEVLAQIISKSNDQSAIVRDTVLDLLGTYIMAYR 846 Query: 285 ETVVRIQLLNLYYI*IMPNLEIVKCTAIKKLCITDQRIRQMDVRVSTHGK 434 ET+ Q+ I IV+ AIK+LC + +++RV K Sbjct: 847 ETIP--QIYGCIISGISDPSTIVRKRAIKQLCEVYEATEDLNIRVDIASK 894 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,526,934 Number of Sequences: 5004 Number of extensions: 50979 Number of successful extensions: 84 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 84 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 84 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 289756512 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -