BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_pT_A19 (340 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_10192| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.7 SB_9403| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.9 SB_50701| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.0 >SB_10192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 373 Score = 28.3 bits (60), Expect = 1.7 Identities = 14/43 (32%), Positives = 27/43 (62%), Gaps = 4/43 (9%) Frame = +3 Query: 54 LTNVISCRGQRRVS----DGNSSSSRGVWRYHGGY*AGCINVV 170 L ++S +G+ RV DG ++++R V+ Y+G + GC +V+ Sbjct: 330 LQTILSVKGEFRVGPYKVDGYAAATRTVYEYYGCFYHGCPSVL 372 >SB_9403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 564 Score = 27.5 bits (58), Expect = 2.9 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +3 Query: 177 RVWEKLRSWFRRCLRVWSGQR 239 R+W K SW + C R W ++ Sbjct: 393 RLWPKCASWLKTCSRRWPSEK 413 >SB_50701| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 311 Score = 25.8 bits (54), Expect = 9.0 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = +2 Query: 26 WRDGAKSSFFNERNKLPRAAQSK 94 W D +SS F+ R K+PR ++ + Sbjct: 107 WEDFTQSSMFSGRQKIPRDSRGR 129 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,046,967 Number of Sequences: 59808 Number of extensions: 134968 Number of successful extensions: 342 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 337 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 342 length of database: 16,821,457 effective HSP length: 73 effective length of database: 12,455,473 effective search space used: 485763447 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -