BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_pT_A18 (603 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein pr... 22 4.6 AJ845188-1|CAH60165.1| 517|Tribolium castaneum putative esteras... 22 4.6 AJ844897-1|CAH59956.1| 517|Tribolium castaneum esterase protein. 22 4.6 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 21 6.1 DQ855491-1|ABH88178.1| 144|Tribolium castaneum chemosensory pro... 21 8.0 >AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein protein. Length = 392 Score = 21.8 bits (44), Expect = 4.6 Identities = 13/52 (25%), Positives = 22/52 (42%), Gaps = 6/52 (11%) Frame = -3 Query: 256 WSTITTLSTTPSYSAKGL------RTFITFYPRCHPPLASPFRAFWPMIRLT 119 WS +TP+Y +GL T +F PP +P A + + ++ Sbjct: 178 WSATPQAGSTPTYQTQGLLSPSYGGTTYSFTADFRPPQETPVLASYKSVPMS 229 >AJ845188-1|CAH60165.1| 517|Tribolium castaneum putative esterase protein. Length = 517 Score = 21.8 bits (44), Expect = 4.6 Identities = 11/21 (52%), Positives = 12/21 (57%), Gaps = 1/21 (4%) Frame = +1 Query: 346 IVEMTL-NDCPGEPGDFPHLV 405 IVEM N+ PG P DF V Sbjct: 314 IVEMMRKNETPGMPNDFEEFV 334 >AJ844897-1|CAH59956.1| 517|Tribolium castaneum esterase protein. Length = 517 Score = 21.8 bits (44), Expect = 4.6 Identities = 11/21 (52%), Positives = 12/21 (57%), Gaps = 1/21 (4%) Frame = +1 Query: 346 IVEMTL-NDCPGEPGDFPHLV 405 IVEM N+ PG P DF V Sbjct: 314 IVEMMRKNETPGMPNDFEEFV 334 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 21.4 bits (43), Expect = 6.1 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = -2 Query: 254 VYHHNAKYDSK 222 +Y+H A YDSK Sbjct: 166 LYNHTANYDSK 176 >DQ855491-1|ABH88178.1| 144|Tribolium castaneum chemosensory protein 5 protein. Length = 144 Score = 21.0 bits (42), Expect = 8.0 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -2 Query: 464 KSPGSPAGRSMQSMHLN*SATRCGK 390 K P SP GR ++ + + T C K Sbjct: 63 KGPCSPEGRELKKILPDALVTNCSK 87 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 151,169 Number of Sequences: 336 Number of extensions: 3558 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15248386 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -